![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os10g39720.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 125aa MW: 13521.3 Da PI: 11.8489 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 34.3 | 3.9e-11 | 80 | 124 | 2 | 46 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHH CS
Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkv 46
rk+ +++k+q +Le+ F+k+++++ ++++ LA++l+L+ rqV v
LOC_Os10g39720.1 80 RKKLRLSKDQAAVLEDTFNKHNTLNPKQKAALARQLNLKPRQVEV 124
788899*************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.1E-12 | 68 | 124 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.28E-9 | 69 | 124 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 9.977 | 76 | 124 | IPR001356 | Homeobox domain |
| Pfam | PF00046 | 1.6E-8 | 80 | 124 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 5.31E-8 | 80 | 124 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MSSSLFLLPP LFLSLFSPLR LAAGSTGWGG SGRGQERRRE LKRRRRRHTL SSLSGKRGAP 60 SAAAAAVGGS DDEDSDDGSR KKLRLSKDQA AVLEDTFNKH NTLNPKQKAA LARQLNLKPR 120 QVEV* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 41 | 46 | KRRRRR |
| 2 | 78 | 84 | SRKKLRL |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.23043 | 4e-93 | root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | Q7XCK2 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in root provascular and vascular cylinder, provascular and vascular strands of leaves, provascular and vascular strands of the whole panicle, in mature embryo provascular bundles of scutellum and embryonic axis and provascular and vascular strands of young immature spikelet organs. Expressed in differentiating and differentiated xylem and phloem elements, and in outer and inner bundle sheath cells of all vascular bundles. Expressed in auricles, ligules, culm, guard cells brac hairs and pollen. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:9076993}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in root provascular and vascular cylinder, provascular and vascular strands of leaves, provascular and vascular strands of the whole panicle, in mature embryo provascular bundles of scutellum and embryonic axis and provascular and vascular strands of young immature spikelet organs. Expressed in differentiating and differentiated xylem and phloem elements, and in outer and inner bundle sheath cells of all vascular bundles. Expressed in auricles, ligules, culm, guard cells brac hairs and pollen. {ECO:0000269|PubMed:10934011, ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:9076993}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription repressor involved leaf development. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. May act as a regulatory switch to specify provascular cell fate. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:10934011, ECO:0000269|PubMed:9076993}. | |||||
| UniProt | Probable transcription repressor involved leaf development. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. May act as a regulatory switch to specify provascular cell fate. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:9076993}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os10g39720.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin and sucrose in primary root apical region. By wounding in leaves. {ECO:0000269|PubMed:10732669}. | |||||
| UniProt | INDUCTION: By auxin and sucrose in primary root apical region. By wounding in leaves. {ECO:0000269|PubMed:10934011}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os10g39720 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC051633 | 8e-91 | AC051633.7 Oryza sativa chromosome 10 BAC OSJNBb0015I11 genomic sequence, complete sequence. | |||
| GenBank | AP014966 | 8e-91 | AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002467488.1 | 5e-28 | homeobox-leucine zipper protein HOX1 | ||||
| Swissprot | Q40691 | 1e-24 | HOX1_ORYSI; Homeobox-leucine zipper protein HOX1 | ||||
| Swissprot | Q7XC54 | 1e-24 | HOX1_ORYSJ; Homeobox-leucine zipper protein HOX1 | ||||
| TrEMBL | Q7XCK2 | 1e-81 | Q7XCK2_ORYSJ; Homeobox domain containing protein | ||||
| STRING | OBART10G17410.1 | 5e-43 | (Oryza barthii) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G06710.1 | 4e-19 | homeobox from Arabidopsis thaliana | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os10g39720.1 |




