![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os12g41880.2 | ||||||||
| Common Name | LOC4352778, NF-Y22, Os12g0613000, OsHAP2B, OsJ_36853, OSNPB_120613000 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 218aa MW: 23721.1 Da PI: 9.5575 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 104.8 | 7.7e-33 | 108 | 164 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep+YVNaKQy++Il+RRq+Rak+e+ekkl k+rkpylheSRh+hAl+R+Rg gGrF
LOC_Os12g41880.2 108 EEPVYVNAKQYNAILRRRQSRAKAESEKKL-VKGRKPYLHESRHQHALKRARGAGGRF 164
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.7E-35 | 106 | 167 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.332 | 107 | 167 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 2.2E-27 | 109 | 164 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 2.0E-23 | 110 | 132 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 112 | 132 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 2.0E-23 | 141 | 164 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0020039 | anatomy | leaf lamina | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 218 aa Download sequence Send to blast |
MTSVVHDVSG NHGADERQKQ QRQGEPEDQQ EASVTSTDSH TMVATPSTDY ATPYAHHDMA 60 HAMGQIAYAN IDPYYGSLYA AYGGQPMMHP PLVGMHPAGL PLPTDAIEEP VYVNAKQYNA 120 ILRRRQSRAK AESEKKLVKG RKPYLHESRH QHALKRARGA GGRFLNSKSD DKEEHSDSSS 180 RDKQDGVAPR DSGQPSTSPS SKGASSAKQN KKSKTSN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 6e-22 | 107 | 171 | 1 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.5602 | 0.0 | callus| leaf| panicle| stem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | Q2QM93 | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os12g41880.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os12g41880 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB288028 | 0.0 | AB288028.1 Oryza sativa Japonica Group OsHAP2B mRNA for HAP2 subunit of HAP complex, complete cds. | |||
| GenBank | AK065163 | 0.0 | AK065163.1 Oryza sativa Japonica Group cDNA clone:J013002C07, full insert sequence. | |||
| GenBank | HQ839673 | 0.0 | HQ839673.1 Oryza sativa Japonica Group NF-Y transcription factor 22 (NF-Y22) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015618405.1 | 1e-159 | nuclear transcription factor Y subunit A-7 isoform X2 | ||||
| TrEMBL | A0A0E0JCD4 | 1e-158 | A0A0E0JCD4_ORYNI; Uncharacterized protein | ||||
| TrEMBL | A0A0E0RJY2 | 1e-158 | A0A0E0RJY2_ORYRU; Uncharacterized protein | ||||
| TrEMBL | A2ZMP1 | 1e-158 | A2ZMP1_ORYSI; Uncharacterized protein | ||||
| TrEMBL | I1R7T4 | 1e-158 | I1R7T4_ORYGL; Uncharacterized protein | ||||
| TrEMBL | Q2QM93 | 1e-158 | Q2QM93_ORYSJ; CCAAT-box transcription factor complex WHAP5, putative, expressed | ||||
| STRING | ORUFI12G20840.1 | 1e-159 | (Oryza rufipogon) | ||||
| STRING | OS12T0613000-01 | 1e-159 | (Oryza sativa) | ||||
| STRING | ONIVA12G17590.2 | 1e-159 | (Oryza nivara) | ||||
| STRING | ORGLA12G0159000.1 | 1e-159 | (Oryza glaberrima) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6555 | 38 | 53 | Representative plant | OGRP680 | 16 | 72 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 5e-44 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os12g41880.2 |
| Entrez Gene | 4352778 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




