![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LPERR01G13070.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 125aa MW: 13473.3 Da PI: 10.2859 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 61.9 | 7.7e-20 | 21 | 55 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+ C++t+Tp+WR+gp g+++LCnaCG++yrkk++
LPERR01G13070.2 21 CVECRATTTPMWRSGPTGPRSLCNACGIRYRKKRR 55
********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 12.848 | 15 | 51 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 2.0E-17 | 15 | 73 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 2.52E-13 | 18 | 55 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 3.3E-16 | 19 | 56 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 2.27E-13 | 20 | 56 | No hit | No description |
| Pfam | PF00320 | 1.4E-17 | 21 | 55 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 21 | 46 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009416 | Biological Process | response to light stimulus | ||||
| GO:0048527 | Biological Process | lateral root development | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MGSTDRKVVG IGVGEEGRRS CVECRATTTP MWRSGPTGPR SLCNACGIRY RKKRRQDLGL 60 DLNQPQKQNG EVIPEVKDSN SNSSSGSSSS NLQVVQKRRL LMGVEEAALL LMTLSSPSAS 120 TLLHG |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LPERR01G13070.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT132400 | 1e-135 | BT132400.1 Oryza sativa clone RRlibD00393 mRNA sequence. | |||
| GenBank | CT829626 | 1e-135 | CT829626.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA214F08, full insert sequence. | |||
| GenBank | CT841570 | 1e-135 | CT841570.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C102C07, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015621366.1 | 1e-69 | GATA transcription factor 23 | ||||
| TrEMBL | A0A0D9V0K9 | 5e-85 | A0A0D9V0K9_9ORYZ; Uncharacterized protein | ||||
| STRING | LPERR01G13070.2 | 9e-86 | (Leersia perrieri) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26930.1 | 2e-18 | GATA transcription factor 23 | ||||




