PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

LPERR01G21760.1

Organism

Leersia perrieri

Taxonomic ID

77586

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia

Family

MYB_related

Protein Properties

Length: 102aa MW: 11454.1 Da PI: 10.904

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
LPERR01G21760.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.9	7.3e-16	28	75	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd l +v+ G g W+++ar g++Rt+k+c++rw++yl LPERR01G21760.1 28 KGPWTVEEDIVLMSYVAVNGLGGWDSVARGTGLNRTGKSCRLRWLNYL 75 79*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	20.804	23	79	IPR017930	Myb domain
SuperFamily	SSF46689	7.48E-17	25	82	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	6.8E-18	26	77	IPR009057	Homeodomain-like
SMART	SM00717	4.1E-11	27	77	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-14	28	75	IPR001005	SANT/Myb domain
CDD	cd00167	7.80E-10	30	75	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 102 aa Download sequence Send to blast
MEYAATQFMS GGRHQHHARP LVPAAVRKGP WTVEEDIVLM SYVAVNGLGG WDSVARGTGL 60 NRTGKSCRLR WLNYLRPGVR RRAPVQMGQQ VVQDREAPPW TD

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor acting redundantly with MYB21 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB21 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269\|PubMed:16805732, ECO:0000269\|PubMed:16972096, ECO:0000269\|PubMed:19091873, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21447791}.
UniProt	Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269\|PubMed:11967090, ECO:0000269\|PubMed:16805732, ECO:0000269\|PubMed:19091873, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21447791}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	LPERR01G21760.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by jasmonate. {ECO:0000269\|PubMed:16805732}.
UniProt	INDUCTION: Up-regulated by jasmonate. {ECO:0000269\|PubMed:16805732}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006644414.2	2e-25	PREDICTED: myb-related protein 340-like
Swissprot	Q9LK95	8e-24	MYB21_ARATH; Transcription factor MYB21
Swissprot	Q9SPG9	6e-24	MYB24_ARATH; Transcription factor MYB24
TrEMBL	A0A0D9V3S9	2e-69	A0A0D9V3S9_9ORYZ; Uncharacterized protein
STRING	LPERR01G21760.1	4e-70	(Leersia perrieri)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G40350.1	3e-26	myb domain protein 24

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Su Z, et al. Flower development under drought stress: morphological and transcriptomic analyses reveal acute responses and long-term acclimation in Arabidopsis. Plant Cell, 2013. 25(10): p. 3785-807 [PMID:24179129] Liu Z, et al. A Conserved Cytochrome P450 Evolved in Seed Plants Regulates Flower Maturation. Mol Plant, 2015. 8(12): p. 1751-65 [PMID:26388305] Chen X,Huang H,Qi T,Liu B,Song S New perspective of the bHLH-MYB complex in jasmonate-regulated plant fertility in arabidopsis. Plant Signal Behav, 2016. 11(2): p. e1135280 [PMID:26829586] Huang H, et al. Arabidopsis MYB24 Regulates Jasmonate-Mediated Stamen Development. Front Plant Sci, 2017. 8: p. 1525 [PMID:28928760]