![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LPERR01G31230.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 174aa MW: 18615.1 Da PI: 8.6348 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 177.2 | 1.6e-55 | 19 | 111 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrkting+dll+a++tlGfe+yv+plk+yl+kyre+
LPERR01G31230.2 19 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGEDLLYAMGTLGFEEYVDPLKIYLHKYREV 111
69*****************************************************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.3E-51 | 18 | 113 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.26E-39 | 22 | 136 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.3E-28 | 25 | 89 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 7.6E-22 | 53 | 71 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 56 | 72 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 7.6E-22 | 72 | 90 | No hit | No description |
| PRINTS | PR00615 | 7.6E-22 | 91 | 109 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0006412 | Biological Process | translation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0022627 | Cellular Component | cytosolic small ribosomal subunit | ||||
| GO:0003735 | Molecular Function | structural constituent of ribosome | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 174 aa Download sequence Send to blast |
MADVGSHDES GSPPRGGMVR EQDRFLPIAN ISRIMKKAVP ANGKIAKDAK ETLQECVSEF 60 ISFVTSEASD KCQKEKRKTI NGEDLLYAMG TLGFEEYVDP LKIYLHKYRE VSFLGDSKLS 120 SKAGDGSVKK EGIGPHGGAG SSSAQGMVGA YAQGMGYMQP QLGYVTKTGK ANIG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-48 | 20 | 110 | 3 | 93 | NF-YB |
| 4awl_B | 2e-48 | 20 | 110 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-48 | 20 | 110 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4g91_B | 2e-48 | 19 | 110 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-48 | 19 | 110 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LPERR01G31230.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB095438 | 1e-166 | AB095438.1 Oryza sativa Japonica Group OsHAP3A mRNA for HAP3, complete cds. | |||
| GenBank | AY332466 | 1e-166 | AY332466.1 Oryza sativa (japonica cultivar-group) CCAAT-binding protein (CCB1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015611523.1 | 9e-95 | nuclear transcription factor Y subunit B-2 isoform X2 | ||||
| Swissprot | Q5QMG3 | 3e-96 | NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2 | ||||
| TrEMBL | A0A0D9V7H8 | 1e-124 | A0A0D9V7H8_9ORYZ; Uncharacterized protein | ||||
| STRING | LPERR01G31230.1 | 1e-118 | (Leersia perrieri) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 2e-64 | nuclear factor Y, subunit B8 | ||||




