![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LPERR09G00210.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 87aa MW: 9658.32 Da PI: 9.4656 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 73.3 | 4.7e-23 | 7 | 73 | 1 | 67 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAea 67
+Ca+Ck+l+r+C +d v+ pyfpae++++fa vh +FGa nv+k+l+++ r d++sslvyeA +
LPERR09G00210.1 7 PCASCKLLQRQCMPDSVFMPYFPAEKAQQFARVHCVFGAINVSKMLHDVLLALRADVVSSLVYEATV 73
7****************************************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 15.198 | 6 | 87 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 7.9E-23 | 7 | 73 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
MAGNGTPCAS CKLLQRQCMP DSVFMPYFPA EKAQQFARVH CVFGAINVSK MLHDVLLALR 60 ADVVSSLVYE ATVSPRGIPP HHRRRPH |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 1e-22 | 3 | 71 | 7 | 75 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 1e-22 | 3 | 71 | 7 | 75 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LPERR09G00210.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015697528.1 | 3e-28 | PREDICTED: LOB domain-containing protein 12-like | ||||
| Swissprot | Q9SHE9 | 6e-23 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
| TrEMBL | A0A0D9XB57 | 4e-58 | A0A0D9XB57_9ORYZ; Uncharacterized protein | ||||
| STRING | LPERR09G00210.1 | 6e-59 | (Leersia perrieri) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G31320.1 | 8e-26 | LOB domain-containing protein 4 | ||||




