![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LPERR10G06370.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 126aa MW: 14192.8 Da PI: 8.7521 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 76.9 | 3.9e-24 | 18 | 74 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
dep+YVNaKQy++Il+RRq+R++l +e+k+ ++ rk++l SR+k+A+ R+Rg+gGrF
LPERR10G06370.1 18 DEPIYVNAKQYHAILRRRQQRKNLGSEDKV-AAIRKRMLTASRKKQAKLRRRGKGGRF 74
79****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 4.1E-20 | 16 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 23.717 | 17 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 3.0E-18 | 19 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 2.9E-14 | 20 | 42 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 2.9E-14 | 51 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 126 aa Download sequence Send to blast |
MGMEHTSMLP LPTEHSDDEP IYVNAKQYHA ILRRRQQRKN LGSEDKVAAI RKRMLTASRK 60 KQAKLRRRGK GGRFISTEDP FEGSVDDQSS ENRGSISPCP SETSSNVNII TGDELSLDHD 120 HNSCNQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 1e-15 | 18 | 98 | 2 | 77 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LPERR10G06370.1 |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015697306.1 | 3e-51 | PREDICTED: nuclear transcription factor Y subunit alpha-like | ||||
| Swissprot | Q93ZH2 | 6e-17 | NFYA3_ARATH; Nuclear transcription factor Y subunit A-3 | ||||
| TrEMBL | A0A0D9XJE1 | 3e-89 | A0A0D9XJE1_9ORYZ; Uncharacterized protein | ||||
| STRING | LPERR10G06370.1 | 5e-90 | (Leersia perrieri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP17468 | 10 | 10 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G72830.1 | 2e-19 | nuclear factor Y, subunit A3 | ||||




