![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LPERR10G06640.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 96aa MW: 10529 Da PI: 9.3975 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 19.7 | 1.5e-06 | 25 | 63 | 16 | 54 |
HHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 16 iNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
i + ++L+ llP+a ++ ++ a +L++++ YI+sL
LPERR10G06640.1 25 IGDLVSKLQALLPEARLRTNDRVPSAKVLQETCSYIRSL 63
5667799*******889********************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47459 | 1.14E-7 | 23 | 84 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 2.2E-6 | 24 | 77 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009416 | Biological Process | response to light stimulus | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MSSRSRSRAR ASASARSTMI TDEQIGDLVS KLQALLPEAR LRTNDRVPSA KVLQETCSYI 60 RSLHREVDDL SDRLTDLLAA ADVSTAQAAV IRSLLM |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LPERR10G06640.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT836589 | 1e-100 | CT836589.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA333Z79, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006661757.1 | 2e-48 | PREDICTED: transcription factor ILI7 | ||||
| Swissprot | A2Z730 | 6e-45 | ILI7_ORYSI; Transcription factor ILI7 | ||||
| Swissprot | Q338G6 | 6e-45 | ILI7_ORYSJ; Transcription factor ILI7 | ||||
| TrEMBL | A0A0D9XJH1 | 5e-59 | A0A0D9XJH1_9ORYZ; Uncharacterized protein | ||||
| STRING | LPERR10G06640.1 | 9e-60 | (Leersia perrieri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2675 | 33 | 78 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 5e-27 | bHLH family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




