![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LPERR12G15680.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 161aa MW: 17824 Da PI: 10.2116 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 105.6 | 4.2e-33 | 57 | 113 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep+YVNaKQy++Il+RRq+Rak+e+ekkl k+rkpylheSRh+hAl+R+Rg gGrF
LPERR12G15680.1 57 EEPVYVNAKQYNAILRRRQSRAKAESEKKL-VKGRKPYLHESRHQHALKRARGAGGRF 113
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.7E-35 | 55 | 116 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.332 | 56 | 116 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.2E-27 | 58 | 113 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 1.2E-23 | 59 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 61 | 81 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 1.2E-23 | 90 | 113 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 161 aa Download sequence Send to blast |
MELMNGKNSK VKGQFAYPNI DPYYGSIYAA YGGQPMMHPP LVGMHPTGLP LPTDAIEEPV 60 YVNAKQYNAI LRRRQSRAKA ESEKKLVKGR KPYLHESRHQ HALKRARGAG GRFLNSKSDD 120 KEEHSDSSSK DKQDGVASHD SGQPSTSPSS VNQNKKSKTC N |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 2e-22 | 56 | 129 | 1 | 74 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LPERR12G15680.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB288028 | 1e-170 | AB288028.1 Oryza sativa Japonica Group OsHAP2B mRNA for HAP2 subunit of HAP complex, complete cds. | |||
| GenBank | AK065163 | 1e-170 | AK065163.1 Oryza sativa Japonica Group cDNA clone:J013002C07, full insert sequence. | |||
| GenBank | HQ839673 | 1e-170 | HQ839673.1 Oryza sativa Japonica Group NF-Y transcription factor 22 (NF-Y22) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015618404.1 | 6e-97 | nuclear transcription factor Y subunit A-7 isoform X1 | ||||
| Swissprot | Q84JP1 | 2e-44 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | A0A0D9Y1D4 | 1e-116 | A0A0D9Y1D4_9ORYZ; Uncharacterized protein | ||||
| STRING | LPERR12G15680.1 | 1e-116 | (Leersia perrieri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6555 | 38 | 53 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 9e-42 | nuclear factor Y, subunit A7 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




