PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj0g3v0107919.1

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

MYB_related

Protein Properties

Length: 82aa MW: 9804.33 Da PI: 10.8003

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj0g3v0107919.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.4	2.6e-16	8	55	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed +lv v ++G ++W+ I+ g++Rt+k+c++rw +yl Lj0g3v0107919.1 8 KGPWTEQEDFKLVSFVGMFGDRRWDFISMVSGLNRTGKSCRLRWVNYL 55 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.6E-18	3	58	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.841	3	59	IPR017930	Myb domain
SMART	SM00717	1.3E-13	7	57	IPR001005	SANT/Myb domain
Pfam	PF00249	7.1E-15	8	55	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.28E-20	9	82	IPR009057	Homeodomain-like
CDD	cd00167	1.00E-9	10	55	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.4E-6	59	82	IPR009057	Homeodomain-like
PROSITE profile	PS51294	7.19	60	82	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 82 aa Download sequence Send to blast
MVQQEFRKGP WTEQEDFKLV SFVGMFGDRR WDFISMVSGL NRTGKSCRLR WVNYLHPGLK 60 RGKLTPQEER MVLELQSKWG NR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	3e-15	1	82	20	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Lja.1955	3e-65	root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269\|PubMed:16531467}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj0g3v0107919.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT149738	4e-67	BT149738.1 Lotus japonicus clone JCVI-FLLj-4E5 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003597326.2	6e-50	transcription factor MYB48
Swissprot	Q4JL84	1e-46	MYB59_ARATH; Transcription factor MYB59
TrEMBL	G7IHL4	1e-48	G7IHL4_MEDTR; Myb transcription factor
STRING	GLYMA15G04620.1	5e-49	(Glycine max)
STRING	XP_007150291.1	5e-49	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF4378	33	59

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G59780.3	6e-49	myb domain protein 59

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]