PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj0g3v0107919.2

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

MYB_related

Protein Properties

Length: 48aa MW: 5570.36 Da PI: 4.8026

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj0g3v0107919.2	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	26	2.1e-08	8	39	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT++Ed +lv v ++G ++W+ I+ g Lj0g3v0107919.2 8 KGPWTEQEDFKLVSFVGMFGDRRWDFISMVSG 39 79***********************9997665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.58E-7	3	37	IPR009057	Homeodomain-like
PROSITE profile	PS51294	9.956	3	48	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.9E-7	3	35	IPR009057	Homeodomain-like
Pfam	PF00249	9.8E-7	8	35	IPR001005	SANT/Myb domain
CDD	cd00167	2.54E-5	10	41	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 48 aa Download sequence Send to blast
MVQQEFRKGP WTEQEDFKLV SFVGMFGDRR WDFISMVSGL KVAGDSNI

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Lja.1955	2e-80	root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269\|PubMed:16531467}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj0g3v0107919.2

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT139912	2e-77	BT139912.1 Lotus japonicus clone JCVI-FLLj-17E8 unknown mRNA.
GenBank	BT149738	2e-77	BT149738.1 Lotus japonicus clone JCVI-FLLj-4E5 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027189439.1	1e-22	transcription factor MYB48-like
Refseq	XP_029128765.1	3e-22	transcription factor MYB48
Swissprot	Q4JL84	1e-16	MYB59_ARATH; Transcription factor MYB59
TrEMBL	A0A3Q7X706	3e-21	A0A3Q7X706_CICAR; transcription factor MYB48-like
STRING	AES67577	1e-21	(Medicago truncatula)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G59780.3	6e-19	myb domain protein 59

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]