![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0173119.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 155aa MW: 17555.2 Da PI: 7.3855 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 175.4 | 5.8e-55 | 26 | 117 | 2 | 93 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
reqdr lPian+srimkk lPan+ki+kdak+t+qecvsefisf+tseas+kcq+ekrktingddllwa+atlGfedy+eplk+yl++yre+
Lj0g3v0173119.1 26 REQDRSLPIANISRIMKKGLPANGKIAKDAKDTMQECVSEFISFITSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKLYLARYREV 117
89****************************************************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.9E-51 | 22 | 116 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.06E-39 | 28 | 117 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.4E-29 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.7E-21 | 59 | 77 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.7E-21 | 78 | 96 | No hit | No description |
| PRINTS | PR00615 | 1.7E-21 | 97 | 115 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 155 aa Download sequence Send to blast |
MADAPTSPVG GSHESGGEQS PRGSAREQDR SLPIANISRI MKKGLPANGK IAKDAKDTMQ 60 ECVSEFISFI TSEASEKCQK EKRKTINGDD LLWAMATLGF EDYIEPLKLY LARYREVILF 120 WLIHRQYVDI CENLMRQLES PILDPHPRKM TLLKC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-46 | 24 | 116 | 1 | 93 | NF-YB |
| 4awl_B | 3e-46 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 3e-46 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4g91_B | 3e-46 | 26 | 116 | 2 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-46 | 26 | 116 | 2 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Lja.20785 | 0.0 | cell culture| pod| root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in leaves, flowers and siliques. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0173119.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JQ918282 | 9e-79 | JQ918282.1 Medicago truncatula nuclear transcription factor Y subunit B9 (NF-YB9) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027366148.1 | 2e-74 | nuclear transcription factor Y subunit B-1-like | ||||
| Swissprot | Q9SLG0 | 4e-63 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A251NV35 | 4e-72 | A0A251NV35_PRUPE; Uncharacterized protein | ||||
| TrEMBL | A0A3N7FTH0 | 1e-71 | A0A3N7FTH0_POPTR; Uncharacterized protein | ||||
| STRING | cassava4.1_017552m | 3e-72 | (Manihot esculenta) | ||||
| STRING | XP_002523912.1 | 4e-72 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2545 | 33 | 82 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.6 | 3e-66 | nuclear factor Y, subunit B1 | ||||




