![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0178269.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 68aa MW: 7451.17 Da PI: 3.7498 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 31.8 | 3.6e-10 | 37 | 67 | 2 | 32 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES- CS
HSF_DNA-bind 2 Flkklyeiledeelkeliswsengnsfvvld 32
Fl+k+y+++ed++++++isw+++g++f+v++
Lj0g3v0178269.1 37 FLTKTYQLVEDQSIDDVISWNDDGSTFIVWN 67
9*****************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 2.4E-10 | 28 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 1.02E-8 | 34 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 9.3E-7 | 37 | 67 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
MAPPPPPPPP VEQHNADSYS PAAASSLESQ RSIPTPFLTK TYQLVEDQSI DDVISWNDDG 60 STFIVWNP |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Lja.13024 | 1e-106 | cell culture| protoplast | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0178269.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017438576.1 | 7e-26 | PREDICTED: heat stress transcription factor B-2a-like | ||||
| Refseq | XP_027924957.1 | 7e-26 | heat stress transcription factor B-2a-like | ||||
| Swissprot | Q9SCW4 | 2e-18 | HFB2A_ARATH; Heat stress transcription factor B-2a | ||||
| TrEMBL | A0A0L9VIV6 | 2e-24 | A0A0L9VIV6_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A0S3TBP5 | 2e-24 | A0A0S3TBP5_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A4D6M0Z7 | 2e-24 | A0A4D6M0Z7_VIGUN; Heat shock transcription factor | ||||
| STRING | XP_007152318.1 | 5e-24 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62020.1 | 6e-21 | heat shock transcription factor B2A | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




