![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0195189.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 61aa MW: 7247.35 Da PI: 10.2326 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 56.6 | 5.9e-18 | 10 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+ T++Ed+l+++ + +lG++ W++Ia +++ gRt++++k++w+++l
Lj0g3v0195189.1 10 RGNITPDEDDLIIRMHSLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 55
8999******************.*********.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 3.73E-16 | 1 | 59 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 8.9E-27 | 1 | 59 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.994 | 5 | 59 | IPR017930 | Myb domain |
| SMART | SM00717 | 4.4E-14 | 9 | 57 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.0E-16 | 10 | 55 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.43E-12 | 14 | 55 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MNYLRPDIKR GNITPDEDDL IIRMHSLLGN RWSLIAGRIP GRTDNEIKNY WNTHLCKKLR 60 N |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 2e-15 | 2 | 59 | 51 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Siliques. {ECO:0000269|PubMed:9839469}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0195189.1 |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014524093.1 | 4e-36 | transcription repressor MYB6 | ||||
| Refseq | XP_017405792.1 | 3e-36 | PREDICTED: transcription repressor MYB6-like | ||||
| Refseq | XP_027906642.1 | 3e-36 | transcription repressor MYB6-like | ||||
| Swissprot | Q38850 | 2e-29 | MYB5_ARATH; Transcription repressor MYB5 | ||||
| TrEMBL | A0A371ETC3 | 1e-36 | A0A371ETC3_MUCPR; Transcription repressor MYB4 | ||||
| STRING | GLYMA03G41965.1 | 9e-35 | (Glycine max) | ||||
| STRING | XP_007135274.1 | 2e-34 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G13540.1 | 1e-31 | myb domain protein 5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




