![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0209729.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 149aa MW: 16967.9 Da PI: 7.1294 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 169.3 | 4.7e-53 | 21 | 117 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
v+eq+r+lPianv+rimk+ lP+nakisk+aket+qecvsefisfvtseas+kc++e+rkt+ng+d++wal+tlGf++y+++++ yl++yrele
Lj0g3v0209729.1 21 VKEQERLLPIANVGRIMKQSLPQNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTVNGEDICWALTTLGFDEYADTMRRYLHRYRELE 114
589******************************************************************************************* PP
NF-YB 95 gek 97
+k
Lj0g3v0209729.1 115 VDK 117
987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 3.5E-52 | 20 | 136 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.71E-38 | 24 | 134 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.0E-28 | 27 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.5E-18 | 55 | 73 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 58 | 74 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.5E-18 | 74 | 92 | No hit | No description |
| PRINTS | PR00615 | 2.5E-18 | 93 | 111 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 149 aa Download sequence Send to blast |
MVDINIGGRG SSSSDINGGG VKEQERLLPI ANVGRIMKQS LPQNAKISKE AKETMQECVS 60 EFISFVTSEA SEKCRKERRK TVNGEDICWA LTTLGFDEYA DTMRRYLHRY RELEVDKQLN 120 SNQENRGNSP HHEEKDHELH KLHPRGGVN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 8e-46 | 21 | 112 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 8e-46 | 21 | 112 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0209729.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004508609.1 | 3e-71 | nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O82248 | 5e-52 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A1S2YR61 | 6e-70 | A0A1S2YR61_CICAR; nuclear transcription factor Y subunit B-4-like | ||||
| STRING | XP_004508609.1 | 1e-70 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 1e-54 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




