![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0226409.4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 125aa MW: 14736 Da PI: 4.7485 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 23.4 | 1.4e-07 | 66 | 106 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
WT+eE + l d+++++ + + Ia +++ Rt +++k+r++
Lj0g3v0226409.4 66 WTKEETDELFDLCERFDLR-FIVIADRFPSSRTVEELKDRYY 106
*******************.*********************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF16282 | 1.8E-29 | 39 | 107 | IPR032563 | DAMP1, SANT/Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 2.3E-6 | 60 | 107 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 7.18E-7 | 62 | 107 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MKRSLGNGFL SPVLLVKIIF NYTIGFVLSM VFRLQGIISF AKYNKSVDII RYTDEEYDKH 60 LTNPMWTKEE TDELFDLCER FDLRFIVIAD RFPSSRTVEE LKDRYYSDEV FVCTFSFALG 120 VWEVG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3hm5_A | 2e-18 | 40 | 107 | 7 | 78 | DNA methyltransferase 1-associated protein 1 |
| 4iej_A | 2e-18 | 40 | 107 | 7 | 78 | DNA methyltransferase 1-associated protein 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Lja.7298 | 1e-166 | floral bud| pod| root | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0226409.4 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT142587 | 1e-103 | BT142587.1 Lotus japonicus clone JCVI-FLLj-20D22 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028753746.1 | 7e-42 | SWR1-complex protein 4 | ||||
| Refseq | XP_028753747.1 | 7e-42 | SWR1-complex protein 4 | ||||
| Refseq | XP_028753748.1 | 7e-42 | SWR1-complex protein 4 | ||||
| Refseq | XP_028753749.1 | 7e-42 | SWR1-complex protein 4 | ||||
| Refseq | XP_028753750.1 | 7e-42 | SWR1-complex protein 4 | ||||
| Refseq | XP_028753751.1 | 7e-42 | SWR1-complex protein 4 | ||||
| Swissprot | Q8VZL6 | 4e-36 | SWC4_ARATH; SWR1-complex protein 4 | ||||
| TrEMBL | A0A1S3TRG1 | 3e-40 | A0A1S3TRG1_VIGRR; SWR1-complex protein 4 | ||||
| TrEMBL | A0A445FJT3 | 3e-40 | A0A445FJT3_GLYSO; SWR1-complex protein 4 isoform A | ||||
| TrEMBL | A0A445FJW2 | 2e-40 | A0A445FJW2_GLYSO; SWR1-complex protein 4 isoform E | ||||
| TrEMBL | A0A445FJY8 | 2e-40 | A0A445FJY8_GLYSO; SWR1-complex protein 4 isoform G | ||||
| TrEMBL | A0A445FK17 | 2e-40 | A0A445FK17_GLYSO; SWR1-complex protein 4 isoform D | ||||
| TrEMBL | A0A4D6MBH0 | 3e-40 | A0A4D6MBH0_VIGUN; DNA methyltransferase 1-associated protein 1 | ||||
| TrEMBL | I1NBE9 | 3e-40 | I1NBE9_SOYBN; Uncharacterized protein | ||||
| TrEMBL | K7MZL6 | 2e-40 | K7MZL6_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA19G40630.1 | 5e-41 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47210.1 | 1e-38 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




