![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0252369.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 157aa MW: 17583.7 Da PI: 10.299 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 106.3 | 2.5e-33 | 76 | 132 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
d p+YVNaKQy++Il+RRq+Rakle+++kl +ksrkpylheSRh+hAl+R RgsgGrF
Lj0g3v0252369.1 76 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-IKSRKPYLHESRHRHALNRVRGSGGRF 132
57****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.5E-36 | 74 | 135 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 37.186 | 75 | 135 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.5E-28 | 78 | 132 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 4.6E-25 | 78 | 100 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 80 | 100 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 4.6E-25 | 109 | 132 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 157 aa Download sequence Send to blast |
MKSFLFMNHS ETEPSYSQVD CNNSMAHAPY PYGEPIFAGP FVAYGPQDVN QPQMLLPHML 60 GLASTRVALP LDLAQDGPIY VNAKQYHGIL RRRQSRAKLE AQNKLIKSRK PYLHESRHRH 120 ALNRVRGSGG RFLSTKQLSQ SNAEFVTGGH SGSVNFX |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 1e-23 | 76 | 137 | 2 | 63 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the whole plant, except roots. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:17322342}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0252369.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT099370 | 4e-99 | BT099370.1 Soybean clone JCVI-FLGm-13B20 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012574919.1 | 8e-89 | nuclear transcription factor Y subunit A-4-like | ||||
| Swissprot | Q9SYH4 | 4e-37 | NFYA5_ARATH; Nuclear transcription factor Y subunit A-5 | ||||
| TrEMBL | A0A2K3P9J4 | 5e-90 | A0A2K3P9J4_TRIPR; Nuclear transcription factor Y subunit A-3-like protein | ||||
| STRING | XP_004513462.1 | 5e-88 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF6949 | 31 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G54160.1 | 2e-39 | nuclear factor Y, subunit A5 | ||||




