![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0252679.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 96aa MW: 10314.4 Da PI: 8.332 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 61 | 2.3e-19 | 63 | 96 | 2 | 35 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCka 35
++++l+cprCds+ntkfCyynny+l+qPr+fCk+
Lj0g3v0252679.1 63 ENQNLRCPRCDSSNTKFCYYNNYNLTQPRHFCKT 96
57899***************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 6.0E-12 | 63 | 96 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 1.7E-15 | 65 | 96 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 18.007 | 67 | 96 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MIQELLDGGA SLIAGERKSS NNPVGGVLLP SPPSQTPSST TTTHTTTSTP TTTTVTATTT 60 ASENQNLRCP RCDSSNTKFC YYNNYNLTQP RHFCKT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0252679.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020238611.1 | 5e-29 | dof zinc finger protein DOF1.1 | ||||
| Swissprot | Q9LSL6 | 2e-16 | DOF57_ARATH; Dof zinc finger protein DOF5.7 | ||||
| TrEMBL | A0A0K8K5W4 | 1e-27 | A0A0K8K5W4_CAJCA; Dof protein | ||||
| STRING | GLYMA01G38970.1 | 7e-24 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G51700.1 | 3e-17 | DOF zinc finger protein 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




