![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0274869.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 83aa MW: 9117.54 Da PI: 10.2637 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 64 | 2.6e-20 | 1 | 46 | 14 | 59 |
--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 14 evkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+vkg+++pr+YYrCtsagCp++k++e++ +d + v+itY+g H+h+
Lj0g3v0274869.1 1 MVKGKPHPRNYYRCTSAGCPARKHIETAVDDSNDVIITYKGVHDHD 46
59*******************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 7.3E-19 | 1 | 48 | IPR003657 | WRKY domain |
| SMART | SM00774 | 7.2E-14 | 1 | 47 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 22.791 | 1 | 48 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 4.05E-17 | 1 | 48 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.6E-14 | 2 | 46 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MVKGKPHPRN YYRCTSAGCP ARKHIETAVD DSNDVIITYK GVHDHDMPVP KKRHGQPNAP 60 LVAAAAPASM SKLQLMKNDS PKK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ayd_A | 3e-16 | 2 | 48 | 28 | 74 | WRKY transcription factor 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Lja.4654 | 1e-129 | cell culture| floral bud| flower| pod| root | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0274869.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP010299 | 1e-113 | AP010299.1 Lotus japonicus genomic DNA, chromosome 6, clone: LjT02F19, TM1353, complete sequence. | |||
| GenBank | AP010300 | 1e-113 | AP010300.1 Lotus japonicus genomic DNA, chromosome 6, clone: LjB04H20, BM2019, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007154886.1 | 2e-40 | hypothetical protein PHAVU_003G156300g | ||||
| Swissprot | P59583 | 4e-35 | WRK32_ARATH; Probable WRKY transcription factor 32 | ||||
| TrEMBL | V7CC73 | 5e-39 | V7CC73_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007154886.1 | 8e-40 | (Phaseolus vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G30935.1 | 6e-31 | WRKY DNA-binding protein 32 | ||||




