![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0280059.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | Nin-like | ||||||||
| Protein Properties | Length: 90aa MW: 10421.4 Da PI: 11.0738 | ||||||||
| Description | Nin-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | RWP-RK | 69.2 | 5.8e-22 | 34 | 83 | 3 | 52 |
RWP-RK 3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
++++ +++k+F +i+++Ak+++v+lT LK++CR++ I+RWPh k+ksl
Lj0g3v0280059.1 34 RKLEFAEIKKHFGVKITEVAKNMNVGLTHLKKRCRELKIMRWPHKKLKSL 83
6899********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51519 | 13.56 | 19 | 90 | IPR003035 | RWP-RK domain |
| Pfam | PF02042 | 3.6E-20 | 36 | 83 | IPR003035 | RWP-RK domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MEEEEKLEKM PMPLALMLPS SSSSKVRGVK SSSRKLEFAE IKKHFGVKIT EVAKNMNVGL 60 THLKKRCREL KIMRWPHKKL KSLNSRGNWS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0280059.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT134923 | 1e-149 | BT134923.1 Lotus japonicus clone JCVI-FLLj-5K18 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019414766.1 | 8e-24 | PREDICTED: protein RKD2-like | ||||
| Swissprot | Q9LVU8 | 1e-15 | RKD4_ARATH; Protein RKD4 | ||||
| TrEMBL | I3S376 | 9e-57 | I3S376_LOTJA; Uncharacterized protein | ||||
| STRING | GLYMA06G13540.2 | 2e-19 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF6898 | 32 | 47 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53040.1 | 2e-17 | RWP-RK domain-containing protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




