PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj0g3v0326419.1

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

NF-YB

Protein Properties

Length: 126aa MW: 14140 Da PI: 4.9472

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj0g3v0326419.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	156.4	4.7e-49	2	97	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 ++qdr+lPianv+rimk+ lP akisk+ k+++qecv+ef+sfvt+easdkc++e+rkt+ngdd++wal++lGf++y++++ yl kyr++e++k Lj0g3v0326419.1 2 EDQDRLLPIANVGRIMKQNLPPSAKISKEGKQMMQECVTEFVSFVTGEASDKCHKENRKTVNGDDICWALSSLGFDNYADAVGRYLLKYRQAERDK 97 69*******************************************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.0E-45	2	98	IPR009072	Histone-fold
SuperFamily	SSF47113	1.71E-35	4	103	IPR009072	Histone-fold
Pfam	PF00808	4.4E-25	7	71	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	5.1E-17	35	53	No hit	No description
PRINTS	PR00615	5.1E-17	54	72	No hit	No description
PRINTS	PR00615	5.1E-17	73	91	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 126 aa Download sequence Send to blast
MEDQDRLLPI ANVGRIMKQN LPPSAKISKE GKQMMQECVT EFVSFVTGEA SDKCHKENRK 60 TVNGDDICWA LSSLGFDNYA DAVGRYLLKY RQAERDKIIM NQNQQILLAP LGCTEKDENS 120 PANESG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-41	1	92	1	92	Transcription factor HapC (Eurofung)
4g92_B	1e-41	1	92	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00133	DAP	Transfer from AT1G09030	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj0g3v0326419.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC235914	1e-83	AC235914.2 Glycine max clone GM_WBc0225O17, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014511823.1	4e-63	nuclear transcription factor Y subunit B-4
Swissprot	O04027	8e-54	NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBL	A0A1S3V0F5	8e-62	A0A1S3V0F5_VIGRR; nuclear transcription factor Y subunit B-4
STRING	XP_007144936.1	8e-60	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF805	32	131

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09030.1	3e-56	nuclear factor Y, subunit B4

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]