![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0343029.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 76aa MW: 8633.82 Da PI: 8.9966 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 60.9 | 2.8e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd lv +++++G+g+Wk++++ g+ R+ k+c++rw +yl
Lj0g3v0343029.1 14 KGPWTPEEDITLVSYIQEHGPGNWKAVPANTGLSRCSKSCRLRWTNYL 61
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.7E-26 | 5 | 72 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.47E-20 | 8 | 71 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 25.128 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 5.1E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.2E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 7.43E-12 | 16 | 61 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MGRPPCCDKE GVKKGPWTPE EDITLVSYIQ EHGPGNWKAV PANTGLSRCS KSCRLRWTNY 60 LRPGIKRGNF TEQEEK |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Lja.25857 | 1e-127 | floral bud | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers, leaves and weakly in seed pods. {ECO:0000269|PubMed:1840903}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0343029.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT137708 | 1e-124 | BT137708.1 Lotus japonicus clone JCVI-FLLj-17B11 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027359006.1 | 6e-50 | myb-related protein 306-like | ||||
| Swissprot | P81392 | 4e-47 | MYB06_ANTMA; Myb-related protein 306 | ||||
| TrEMBL | I3SB61 | 2e-49 | I3SB61_LOTJA; Uncharacterized protein | ||||
| STRING | GLYMA13G05370.1 | 2e-48 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G47600.1 | 1e-48 | myb domain protein 94 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




