![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj0g3v0354159.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 83aa MW: 9684.43 Da PI: 9.574 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 47.3 | 3.6e-15 | 3 | 81 | 17 | 98 |
E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
++p++f++e+ ++ ++ t++l+ + + W vkli k+g+ l+kGW eF+ +L +gD +vF+l+++++ l v++fr
Lj0g3v0354159.1 3 RVPNPFIREYFNDMQQ--TIMLQY-EKKLWPVKLICYPKKGSGKLSKGWVEFAGKSKLVVGDACVFELINKEDPVLDVHIFR 81
58********766434..677665.889******9977777778*************************9999999999998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 12.323 | 1 | 83 | IPR003340 | B3 DNA binding domain |
| SMART | SM01019 | 0.0018 | 1 | 83 | IPR003340 | B3 DNA binding domain |
| Gene3D | G3DSA:2.40.330.10 | 8.9E-17 | 2 | 81 | IPR015300 | DNA-binding pseudobarrel domain |
| SuperFamily | SSF101936 | 1.04E-15 | 3 | 81 | IPR015300 | DNA-binding pseudobarrel domain |
| CDD | cd10017 | 3.54E-13 | 3 | 81 | No hit | No description |
| Pfam | PF02362 | 1.4E-13 | 3 | 82 | IPR003340 | B3 DNA binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MQRVPNPFIR EYFNDMQQTI MLQYEKKLWP VKLICYPKKG SGKLSKGWVE FAGKSKLVVG 60 DACVFELINK EDPVLDVHIF RGH |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Lja.4907 | 1e-138 | floral bud| root | ||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj0g3v0354159.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP004896 | 4e-76 | AP004896.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT16I07, TM0040, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019459711.1 | 2e-24 | PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1 | ||||
| Refseq | XP_019459713.1 | 2e-24 | PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X2 | ||||
| TrEMBL | A0A2K3L3W7 | 3e-26 | A0A2K3L3W7_TRIPR; B3 domain-containing protein | ||||
| STRING | AES62834 | 4e-21 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF98 | 34 | 369 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G49480.1 | 1e-14 | related to vernalization1 1 | ||||




