![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj1g3v0579530.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 87aa MW: 10238.8 Da PI: 10.725 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 120.8 | 4.8e-38 | 19 | 78 | 2 | 61 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
++++lkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrn+ vG+g+rk k+s
Lj1g3v0579530.1 19 HHQILKCPRCESLNTKFCYYNNYNLSQPRHFCKGCRRYWTKGGLLRNITVGSGSRKPKRS 78
57899***************************************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 2.0E-24 | 19 | 77 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 1.6E-32 | 21 | 77 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 27.587 | 23 | 77 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 25 | 61 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
MQEIHDHSMT ERKVPRPHHH QILKCPRCES LNTKFCYYNN YNLSQPRHFC KGCRRYWTKG 60 GLLRNITVGS GSRKPKRSIN KNTVPSA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj1g3v0579530.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | DQ857273 | 2e-44 | DQ857273.1 Glycine max Dof22 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018463728.1 | 7e-34 | PREDICTED: dof zinc finger protein DOF5.4-like | ||||
| Swissprot | Q8LDR0 | 8e-33 | DOF54_ARATH; Dof zinc finger protein DOF5.4 | ||||
| TrEMBL | A0A4D9AF69 | 2e-34 | A0A4D9AF69_SALSN; Uncharacterized protein | ||||
| STRING | evm.model.supercontig_3.229 | 5e-33 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5998 | 30 | 50 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60850.1 | 4e-35 | OBF binding protein 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




