![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj1g3v2035100.1 | ||||||||
| Common Name | bZIP-R91 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 186aa MW: 20499.4 Da PI: 5.3194 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 50.1 | 5.9e-16 | 131 | 177 | 3 | 49 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49
++kr rrk +NRe+ArrsR+RK+a ++eLe+ v++L+ eN +L k+
Lj1g3v2035100.1 131 DVKRLRRKVSNRESARRSRRRKQAHLAELETQVEKLKLENATLYKQF 177
68*****************************************9764 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 6.9E-13 | 127 | 184 | No hit | No description |
| SMART | SM00338 | 2.8E-10 | 129 | 186 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 11.691 | 131 | 186 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 1.5E-13 | 132 | 177 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 2.44E-11 | 133 | 183 | No hit | No description |
| CDD | cd14702 | 1.19E-7 | 134 | 185 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 136 | 151 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0071333 | Biological Process | cellular response to glucose stimulus | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 186 aa Download sequence Send to blast |
MASSETADLN EFLNLDYDHL RYPDTADALF NTVCSAAFHN LLPDVVSSFS TCGGVTVTDT 60 LYSQKLTPKC STVTATNDSQ SSICVGSPVS ANKPNMGGEN HLKGTSSGSS DRSDEDDDEA 120 GPCEQSNNPQ DVKRLRRKVS NRESARRSRR RKQAHLAELE TQVEKLKLEN ATLYKQFTDA 180 SQQFRE |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 135 | 151 | RRKVSNRESARRSRRRK |
| 2 | 145 | 152 | RRSRRRKQ |
| 3 | 147 | 152 | SRRRKQ |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Lja.3181 | 0.0 | floral bud| pod| root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in developing seeds from 10 to 30 days after flowering (DAF). {ECO:0000269|PubMed:11133985}. | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in developing seeds from 10 to 30 days after flowering (DAF). {ECO:0000269|PubMed:11133985}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in developing endosperm, especially in aleurone layer cells. {ECO:0000269|PubMed:7919992}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters. {ECO:0000269|PubMed:11133985}. | |||||
| UniProt | Transcriptional activator that possesses broad binding specificity for DNA promoter elements with the core sequence 5'-ACGT-3'. May be involved in the regulation of genes expressed during seed development (PubMed:7919992). Binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters (PubMed:11133985). {ECO:0000269|PubMed:11133985, ECO:0000269|PubMed:7919992}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj1g3v2035100.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB378629 | 0.0 | AB378629.1 Lotus japonicus bZIP-R91 mRNA for transcription factor bZIP, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004501207.1 | 2e-78 | bZIP transcription factor RISBZ4-like | ||||
| Swissprot | Q6ETX0 | 2e-38 | RSBZ3_ORYSJ; bZIP transcription factor RISBZ3 | ||||
| Swissprot | Q6H500 | 1e-38 | RSBZ4_ORYSJ; bZIP transcription factor RISBZ4 | ||||
| TrEMBL | B3IX29 | 1e-134 | B3IX29_LOTJA; Transcription factor bZIP | ||||
| STRING | XP_004501207.1 | 6e-78 | (Cicer arietinum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G24800.1 | 5e-22 | basic leucine zipper 9 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




