PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v3847230.1
Organism
Lotus japonicus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 160aa    MW: 18563.7 Da    PI: 9.7768
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v3847230.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.4e-3381139159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+
  Lj1g3v3847230.1  81 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHHGCNVKKQVQRLTKDEGVVVTTYEGVHTHP 139
                      59********************************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.4E-3466139IPR003657WRKY domain
SuperFamilySSF1182907.72E-3073140IPR003657WRKY domain
PROSITE profilePS5081129.58576141IPR003657WRKY domain
SMARTSM007745.1E-3981140IPR003657WRKY domain
PfamPF031068.9E-2782139IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MENNNNYSML FPCPSSSTSV VGSSHNGYSG LNNDHQFEKR VEDARDGILS QINVSDNKKK  60
GEKKARKPRY AFQTRSQVDI LDDGYRWRKY GQKAVKNNKF PRSYYRCTHH GCNVKKQVQR  120
LTKDEGVVVT TYEGVHTHPI EKTTDNFEHI LNQMQIYTPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2771140776Probable WRKY transcription factor 4
2lex_A3e-2771140776Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.106320.0root
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v3847230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1421240.0BT142124.1 Lotus japonicus clone JCVI-FLLj-20G12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027351978.12e-78probable WRKY transcription factor 75
SwissprotQ9FYA26e-57WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLI3SNS61e-118I3SNS6_LOTJA; Uncharacterized protein
STRINGXP_007161664.12e-73(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.17e-59WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Xu L, et al.
    Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis.
    Plant Cell Rep., 2012. 31(12): p. 2177-88
    [PMID:22890372]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P
    Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract.
    Plant Physiol., 2016. 170(4): p. 2432-43
    [PMID:26884488]
  5. Velasco VM, et al.
    Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes.
    Plant Cell Environ., 2016. 39(8): p. 1818-34
    [PMID:27038434]
  6. Hossain MA, et al.
    Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 650
    [PMID:27242851]
  7. Zhang H,Huang L,Hong Y,Song F
    BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana.
    BMC Plant Biol., 2016. 16(1): p. 152
    [PMID:27389008]
  8. Zhang S, et al.
    The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling.
    Plant Physiol., 2017. 173(4): p. 2294-2307
    [PMID:28250067]
  9. Guo P, et al.
    A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence.
    Plant Cell, 2017. 29(11): p. 2854-2870
    [PMID:29061866]
  10. Zhang L,Chen L,Yu D
    Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering.
    Plant Physiol., 2018. 176(1): p. 790-803
    [PMID:29133369]