![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj2g3v0934070.3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 138aa MW: 15381.4 Da PI: 7.8377 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 138.8 | 1.8e-43 | 11 | 109 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94
+CaaCk+lrrkC +dC+++pyfp e+p+kf nvhk+FGasnv+k+l+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el
Lj2g3v0934070.3 11 PCAACKFLRRKCMSDCIFSPYFPPEEPHKFVNVHKIFGASNVSKILNEVLPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVLRLQKEL 104
7********************************************************************************************* PP
DUF260 95 allke 99
+++++
Lj2g3v0934070.3 105 DAANA 109
99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 27.38 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 5.4E-43 | 11 | 108 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 138 aa Download sequence Send to blast |
MASSSYSNNS PCAACKFLRR KCMSDCIFSP YFPPEEPHKF VNVHKIFGAS NVSKILNEVL 60 PHQREDAVNS LAYEAEARIK DPVYGCVGAI SVLQRQVLRL QKELDAANAD LIRYSACSET 120 PTTHHGGSGF YYPWNNHG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-63 | 2 | 119 | 2 | 118 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-63 | 2 | 119 | 2 | 118 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj2g3v0934070.3 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP009666 | 0.0 | AP009666.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjT30P12, TM0263, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006579776.1 | 3e-81 | LOB domain-containing protein 25 | ||||
| Refseq | XP_014630864.1 | 3e-81 | LOB domain-containing protein 25 | ||||
| Refseq | XP_028231096.1 | 3e-81 | LOB domain-containing protein 25-like | ||||
| Refseq | XP_028231097.1 | 3e-81 | LOB domain-containing protein 25-like | ||||
| Swissprot | Q9FML4 | 5e-69 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A445KHB7 | 7e-80 | A0A445KHB7_GLYSO; LOB domain-containing protein 25 isoform A | ||||
| TrEMBL | K7KNN7 | 7e-80 | K7KNN7_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA05G08870.2 | 1e-80 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 2e-71 | LBD family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




