![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj2g3v1068520.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 42aa MW: 4501.2 Da PI: 8.5178 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 25.3 | 3.6e-08 | 12 | 41 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+g+W++ Ed+ll +v ++G g W++++++
Lj2g3v1068520.1 12 KGAWSKVEDDLLTACVLKYGEGKWHLVPSR 41
79************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 10.865 | 7 | 42 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 5.23E-7 | 9 | 40 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.7E-9 | 9 | 41 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 3.8E-6 | 12 | 41 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.84E-4 | 14 | 41 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 42 aa Download sequence Send to blast |
MEGVGGSLGV RKGAWSKVED DLLTACVLKY GEGKWHLVPS RA |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj2g3v1068520.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019426716.1 | 2e-15 | PREDICTED: transcription factor MYB90-like | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56650.1 | 8e-14 | production of anthocyanin pigment 1 | ||||




