![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj2g3v1278970.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 165aa MW: 19326.2 Da PI: 9.8565 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 172.8 | 1e-53 | 15 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94
l pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s
Lj2g3v1278970.1 15 LLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYS 107
579***************************.89***************9888999*************************************** PP
NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
+ +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
Lj2g3v1278970.1 108 SeGSKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 142
956677***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.09E-56 | 13 | 146 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 52.923 | 15 | 165 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.3E-26 | 17 | 142 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 165 aa Download sequence Send to blast |
MEERNDHAEK LDEVLLPGFR FHPTDEELVG FYLKRKIQQR PLSIELIKQL DIYKYDPWDL 60 PKLASTGEKE WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPIYSSEG SKCIGLKKSL 120 VFYKGRAAKG VKTDWMMHEF RLPSLTDPMS QKKYIDKTIP ANVSN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 5e-52 | 15 | 142 | 17 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 5e-52 | 15 | 142 | 17 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 5e-52 | 15 | 142 | 17 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 5e-52 | 15 | 142 | 17 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 5e-52 | 15 | 142 | 20 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 5e-52 | 15 | 142 | 20 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 5e-52 | 15 | 142 | 20 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 5e-52 | 15 | 142 | 20 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 5e-52 | 15 | 142 | 20 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 5e-52 | 15 | 142 | 20 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 5e-52 | 15 | 142 | 20 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 5e-52 | 15 | 142 | 20 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 5e-52 | 15 | 142 | 17 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 5e-52 | 15 | 142 | 17 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: First expressed at globular stage onward in the COL progenitors after the first division of the hypophyseal cell. Later observed in these cells and their descendants, mostly in direct daughter cells. Also detected in the Epi/LRC stem cells and daughters, and is retained in maturing LRC layers. Present in elongated stem cells that are about to divide. {ECO:0000269|PubMed:19081078}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in root cap stem cells and their immediate daughters. {ECO:0000269|PubMed:19081078}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Promotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj2g3v1278970.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU661928 | 1e-179 | EU661928.1 Glycine max NAC domain protein (NAC36) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027362098.1 | 1e-111 | putative NAC domain-containing protein 94 | ||||
| Swissprot | Q9ZVH0 | 4e-90 | FEZ_ARATH; Protein FEZ | ||||
| TrEMBL | A0A1S2XIY2 | 1e-109 | A0A1S2XIY2_CICAR; protein FEZ | ||||
| STRING | XP_004490046.1 | 1e-109 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2013 | 34 | 90 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26870.1 | 2e-92 | NAC family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




