PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj2g3v1534080.1

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

MYB_related

Protein Properties

Length: 106aa MW: 12169.1 Da PI: 8.8632

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj2g3v1534080.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.6	2.8e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgrW++eEd++l d +kq G g+Wk+ ++ g+ R++k+c++rw +yl Lj2g3v1534080.1 14 RGRWSEEEDKILTDFIKQNGEGSWKSLPKNAGLLRCGKSCRLRWINYL 61 8*****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	9.1E-22	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.541	9	65	IPR017930	Myb domain
SMART	SM00717	3.5E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.4E-15	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.49E-21	15	89	IPR009057	Homeodomain-like
CDD	cd00167	1.70E-9	16	61	No hit	No description
PROSITE profile	PS50090	4.948	62	99	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	5.7E-8	65	88	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MGRAPCCEKV GLKRGRWSEE EDKILTDFIK QNGEGSWKSL PKNAGLLRCG KSCRLRWINY 60 LREDVKRGNI TSEEEEIIVK LHAALGNRCV LLEFKTSNWP IFVSCN

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: In seedlings, predominantly expressed in cotyledons. Restricted to the cotyledons and primary leaves. {ECO:0000269\|PubMed:17419845}.
Uniprot	TISSUE SPECIFICITY: Expressed in seedlings, cotyledons and young leaves. {ECO:0000269\|PubMed:17419845}.

Functional Description ? help Back to Top
Source	Description
UniProt	Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269\|PubMed:17419845, ECO:0000269\|PubMed:19895401, ECO:0000269\|PubMed:20731781}.
UniProt	Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj2g3v1534080.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269\|PubMed:19895401}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027338876.1	8e-51	transcription factor MYB111-like
Swissprot	P27898	3e-47	MYBP_MAIZE; Myb-related protein P
Swissprot	Q9FJ07	9e-48	MY111_ARATH; Transcription factor MYB111
TrEMBL	A0A396J9F4	4e-50	A0A396J9F4_MEDTR; Putative transcription factor MYB-HB-like family
STRING	GLYMA17G03480.2	1e-49	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49330.1	4e-50	myb domain protein 111

Publications ? help Back to Top
Robbins ML,Sekhon RS,Meeley R,Chopra S A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize. Genetics, 2008. 178(4): p. 1859-74 [PMID:18430921] Sidorenko L,Chandler V RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene. Genetics, 2008. 180(4): p. 1983-93 [PMID:18845841] Robbins ML,Wang P,Sekhon RS,Chopra S Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism. PLoS ONE, 2009. 4(12): p. e8231 [PMID:20011605] Rhee Y,Sekhon RS,Chopra S,Kaeppler S Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize. Genetics, 2010. 186(3): p. 843-55 [PMID:20823340] Morohashi K, et al. A genome-wide regulatory framework identifies maize pericarp color1 controlled genes. Plant Cell, 2012. 24(7): p. 2745-64 [PMID:22822204] Pandey A,Misra P,Bhambhani S,Bhatia C,Trivedi PK Expression of Arabidopsis MYB transcription factor, AtMYB111, in tobacco requires light to modulate flavonol content. Sci Rep, 2014. 4: p. 5018 [PMID:24846090] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Zhou Z,Schenke D,Miao Y,Cai D Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings. Plant Cell Environ., 2017. 40(3): p. 453-458 [PMID:28032363] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Duan S, et al. Functional characterization of a heterologously expressed Brassica napus WRKY41-1 transcription factor in regulating anthocyanin biosynthesis in Arabidopsis thaliana. Plant Sci., 2018. 268: p. 47-53 [PMID:29362083]