![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj2g3v2017430.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 70aa MW: 8416.83 Da PI: 10.411 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 62.7 | 7.3e-20 | 14 | 59 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+g+WT+eEd+ l+++v+++G ++W+ +a+ ++ gR +kqc++rw+++
Lj2g3v2017430.2 14 KGPWTKEEDDCLIELVRKYGLKRWSVVAKFLP-GRIGKQCRERWHNH 59
79******************************.************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.44E-23 | 2 | 69 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.5E-6 | 2 | 18 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 29.298 | 9 | 64 | IPR017930 | Myb domain |
| SMART | SM00717 | 5.4E-18 | 13 | 62 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.8E-19 | 14 | 59 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 6.46E-15 | 16 | 59 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.0E-24 | 19 | 62 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MHRWQKVLNP ELVKGPWTKE EDDCLIELVR KYGLKRWSVV AKFLPGRIGK QCRERWHNHH 60 DPAITKVAWT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h88_C | 3e-33 | 1 | 70 | 45 | 114 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 3e-33 | 1 | 70 | 45 | 114 | MYB PROTO-ONCOGENE PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the root quiescent center (PubMed:15937229). Accumulates in division zone of primary root tips and emerging lateral roots. Also present in floral organs in young flower buds. Weakly and uniformly present in the developing embryo and maternal tissues (PubMed:17287251). Expressed specifically in proliferating stage of leaves (PubMed:26069325). {ECO:0000269|PubMed:15937229, ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:26069325}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, cotyledons and leaves, especially in vascular tissues, and in flowers. {ECO:0000269|PubMed:17287251}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669, PubMed:25806785). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:25806785}.; FUNCTION: Involved in transcription regulation during induced endoreduplication at the powdery mildew (e.g. G.orontii) infection site, thus promoting G.orontii growth and reproduction. {ECO:0000269|PubMed:20018666}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj2g3v2017430.2 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Slightly induced by salicylic acid (SA) (PubMed:16463103). Expressed in a cell cycle-dependent manner, with highest levels 2 hours before the peak of mitotic index in cells synchronized by aphidicolin. Activated by CYCB1 (PubMed:17287251). Accumulates at powdery mildew (e.g. G.orontii) infected cells. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17287251}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP006148 | 6e-53 | AP006148.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjT41D09, TM0304, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028118922.1 | 1e-38 | transcription factor MYB3R-4-like isoform X1 | ||||
| Refseq | XP_028118923.1 | 1e-38 | transcription factor MYB3R-4-like isoform X1 | ||||
| Refseq | XP_028118924.1 | 1e-38 | transcription factor MYB3R-4-like isoform X1 | ||||
| Refseq | XP_028118925.1 | 1e-38 | transcription factor MYB3R-4-like isoform X1 | ||||
| Refseq | XP_028118926.1 | 1e-38 | transcription factor MYB3R-4-like isoform X1 | ||||
| Refseq | XP_028118927.1 | 1e-38 | transcription factor MYB3R-4-like isoform X1 | ||||
| Refseq | XP_028118928.1 | 1e-38 | transcription factor MYB3R-4-like isoform X1 | ||||
| Refseq | XP_028118929.1 | 8e-39 | transcription factor MYB3R-4-like isoform X2 | ||||
| Swissprot | Q94FL9 | 6e-37 | MB3R4_ARATH; Transcription factor MYB3R-4 | ||||
| TrEMBL | A0A371GBX9 | 1e-36 | A0A371GBX9_MUCPR; Transcription factor MYB3R-5 (Fragment) | ||||
| STRING | XP_010676520.1 | 2e-36 | (Beta vulgaris) | ||||
| STRING | Aquca_001_00435.1 | 6e-36 | (Aquilegia coerulea) | ||||
| STRING | XP_010249699.1 | 8e-36 | (Nelumbo nucifera) | ||||
| STRING | A0A087G6B1 | 6e-36 | (Arabis alpina) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G11510.1 | 3e-39 | myb domain protein 3r-4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




