![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj2g3v2087990.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 136aa MW: 15394.5 Da PI: 4.9441 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 148.6 | 1.3e-46 | 1 | 88 | 8 | 95 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+Pianv+rim+++lP +akis++aket+qecvsefisfvtsea+++cq+e+rkt++++d+lwa+++lGf+dy+ pl+++l++yr++eg
Lj2g3v2087990.1 1 MPIANVIRIMRRTLPPQAKISDEAKETIQECVSEFISFVTSEANERCQKEQRKTVSAEDVLWAFGKLGFDDYLLPLTLFLHRYRHTEG 88
8************************************************************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 4.03E-33 | 1 | 87 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.8E-26 | 1 | 63 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 2.2E-41 | 1 | 87 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 5.4E-14 | 28 | 46 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 31 | 47 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 5.4E-14 | 47 | 65 | No hit | No description |
| PRINTS | PR00615 | 5.4E-14 | 66 | 84 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MPIANVIRIM RRTLPPQAKI SDEAKETIQE CVSEFISFVT SEANERCQKE QRKTVSAEDV 60 LWAFGKLGFD DYLLPLTLFL HRYRHTEGGL VMPPPPPLPQ PAPGYYYRDD DASASGSSIA 120 PFDSLFHLKR DPDDLI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 3e-48 | 1 | 84 | 13 | 96 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Lja.12033 | 0.0 | root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj2g3v2087990.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003556590.1 | 2e-52 | nuclear transcription factor Y subunit B-6 | ||||
| Refseq | XP_025983113.1 | 2e-52 | nuclear transcription factor Y subunit B-6 | ||||
| Refseq | XP_028219498.1 | 2e-52 | nuclear transcription factor Y subunit B-6-like | ||||
| Refseq | XP_028219500.1 | 2e-52 | nuclear transcription factor Y subunit B-6-like | ||||
| Swissprot | Q84W66 | 2e-47 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A0B2NV02 | 6e-51 | A0A0B2NV02_GLYSO; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | I1NCV5 | 6e-51 | I1NCV5_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA20G00240.1 | 1e-51 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2728 | 32 | 79 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 9e-50 | nuclear factor Y, subunit B6 | ||||




