PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj3g3v0667930.1

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

NAC

Protein Properties

Length: 210aa MW: 23633.8 Da PI: 9.6745

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj3g3v0667930.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	163.1	1e-50	16	141	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrF Pt+eel+v+y+++kv+g++++l +i+e+d+yk++Pw Lp+k+ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ Lj3g3v0667930.1 16 LPPGFRFYPTEEELLVQYICRKVAGHNFTL-PIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT 108 79***********************999.88***********7777799*******************************9999 PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 +g++vg+kk Lvfy g+apkg+kt+W+mheyrl Lj3g3v0667930.1 109 -EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 141 .999**************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.57E-66	12	165	IPR003441	NAC domain
PROSITE profile	PS51005	59.387	16	164	IPR003441	NAC domain
Pfam	PF02365	2.1E-25	17	141	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009414	Biological Process	response to water deprivation
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 210 aa Download sequence Send to blast
MTMGIPEKDP LSQLSLPPGF RFYPTEEELL VQYICRKVAG HNFTLPIIAE IDLYKFDPWV 60 LPSKAIFGEK EWYFFSPRDR KYPNGSRPNR VAGSGYWKAT GTDKIITTEG RKVGIKKALV 120 FYVGKAPKGT KTNWIMHEYR LLDSSQKNTG SRLDDWVLCR IYKKNSSAQR AASNGTVSSR 180 EYTQYSNGSS SSSSSHLDDV MESLPEIGGG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-108	3	170	4	171	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-108	3	170	4	171	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-108	3	170	4	171	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-108	3	170	4	171	NO APICAL MERISTEM PROTEIN
3swm_A	1e-107	3	170	7	174	NAC domain-containing protein 19
3swm_B	1e-107	3	170	7	174	NAC domain-containing protein 19
3swm_C	1e-107	3	170	7	174	NAC domain-containing protein 19
3swm_D	1e-107	3	170	7	174	NAC domain-containing protein 19
3swp_A	1e-107	3	170	7	174	NAC domain-containing protein 19
3swp_B	1e-107	3	170	7	174	NAC domain-containing protein 19
3swp_C	1e-107	3	170	7	174	NAC domain-containing protein 19
3swp_D	1e-107	3	170	7	174	NAC domain-containing protein 19
4dul_A	1e-108	3	170	4	171	NAC domain-containing protein 19
4dul_B	1e-108	3	170	4	171	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Lja.6597	0.0	cell culture\| floral bud\| flower\| pod\| protoplast\| root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in guard cells of the epidermis. {ECO:0000269\|PubMed:25005917}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269\|PubMed:25005917, ECO:0000269\|PubMed:28733419}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00360	DAP	Transfer from AT3G15500	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj3g3v0667930.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269\|PubMed:25005917, ECO:0000269\|PubMed:28733419, ECO:0000269\|PubMed:30610166}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014505280.1	1e-138	NAC domain-containing protein 72
Swissprot	A0A3Q7HH64	1e-113	JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBL	A0A1S3UGX4	1e-136	A0A1S3UGX4_VIGRR; NAC domain-containing protein 72
STRING	XP_007149614.1	1e-135	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF4429	33	60

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G15500.1	1e-114	NAC domain containing protein 3

Publications ? help Back to Top
Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Du M, et al. MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato. Plant Cell, 2017. 29(8): p. 1883-1906 [PMID:28733419] Liu Y, et al. MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop. Plant Cell, 2019. 31(1): p. 106-127 [PMID:30610166]