![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj3g3v0966230.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 158aa MW: 18442.3 Da PI: 10.1267 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 168.5 | 2.2e-52 | 11 | 132 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94
lppGfrFhP+deelv++yL kkv++++ l + +vd++k+ePwd+p++v + kewyf+++rd+kyatg r+nrat+sgyWkatgkd+++++
Lj3g3v0966230.2 11 LPPGFRFHPRDEELVCDYLMKKVTHSDSLL---MIDVDLNKCEPWDIPACV--GGKEWYFYTQRDRKYATGLRTNRATSSGYWKATGKDRAIHR 99
79**********************999544...789************776..779*************************************9 PP
NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
+g+lvg++ktLvfy+grapkg+kt+Wvmhe+r+
Lj3g3v0966230.2 100 -RGTLVGMRKTLVFYQGRAPKGRKTEWVMHEFRI 132
.999****************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.66E-59 | 2 | 156 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 55.642 | 11 | 156 | IPR003441 | NAC domain |
| Pfam | PF02365 | 5.3E-28 | 12 | 132 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 158 aa Download sequence Send to blast |
MSNISMVEAK LPPGFRFHPR DEELVCDYLM KKVTHSDSLL MIDVDLNKCE PWDIPACVGG 60 KEWYFYTQRD RKYATGLRTN RATSSGYWKA TGKDRAIHRR GTLVGMRKTL VFYQGRAPKG 120 RKTEWVMHEF RIEGPHGPPK IPSSKEDWVL CRVFYKSR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 5e-49 | 6 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 5e-49 | 6 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 5e-49 | 6 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 5e-49 | 6 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 4e-49 | 6 | 157 | 15 | 169 | NAC domain-containing protein 19 |
| 3swm_B | 4e-49 | 6 | 157 | 15 | 169 | NAC domain-containing protein 19 |
| 3swm_C | 4e-49 | 6 | 157 | 15 | 169 | NAC domain-containing protein 19 |
| 3swm_D | 4e-49 | 6 | 157 | 15 | 169 | NAC domain-containing protein 19 |
| 3swp_A | 4e-49 | 6 | 157 | 15 | 169 | NAC domain-containing protein 19 |
| 3swp_B | 4e-49 | 6 | 157 | 15 | 169 | NAC domain-containing protein 19 |
| 3swp_C | 4e-49 | 6 | 157 | 15 | 169 | NAC domain-containing protein 19 |
| 3swp_D | 4e-49 | 6 | 157 | 15 | 169 | NAC domain-containing protein 19 |
| 4dul_A | 5e-49 | 6 | 157 | 12 | 166 | NAC domain-containing protein 19 |
| 4dul_B | 5e-49 | 6 | 157 | 12 | 166 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Lja.7609 | 0.0 | root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj3g3v0966230.2 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by auxin. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF725687 | 1e-167 | KF725687.1 Ammopiptanthus mongolicus NAC domain-containing protein (NAC3) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003595973.1 | 1e-111 | NAC domain-containing protein 21/22 | ||||
| Swissprot | Q84TE6 | 2e-88 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
| TrEMBL | F6KIF1 | 1e-109 | F6KIF1_MEDTR; NAC transcription factor-like protein | ||||
| TrEMBL | W0C8Y8 | 1e-109 | W0C8Y8_9FABA; NAC domain-containing protein | ||||
| STRING | AES66224 | 1e-110 | (Medicago truncatula) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56010.2 | 7e-91 | NAC domain containing protein 1 | ||||




