PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj3g3v2578300.1

Common Name

nsp1

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

GRAS

Protein Properties

Length: 57aa MW: 6471.21 Da PI: 4.4298

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj3g3v2578300.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	23.3	7e-08	10	53	303	346
GRAS 303 aerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346 +++re +e++ekW r++eaGF ++e+a++ ++llrk++s Lj3g3v2578300.1 10 TNQREMNEEKEKWCGRMKEAGFAGEVFGEDAVDGGRALLRKYDS 53 567899999********************************984 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50985	9.001	1	57	IPR005202	Transcription factor GRAS
Pfam	PF03514	2.4E-5	10	53	IPR005202	Transcription factor GRAS

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated

Sequence ? help Back to Top
Protein Sequence Length: 57 aa Download sequence Send to blast
MEGEAAKALT NQREMNEEKE KWCGRMKEAG FAGEVFGEDA VDGGRALLRK YDSNWEM

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in epidermal and cortical root cells. {ECO:0000269\|PubMed:15961669}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269\|PubMed:15961669, ECO:0000269\|PubMed:23077241}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj3g3v2578300.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269\|PubMed:15961669}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EF012819	3e-91	EF012819.1 Lotus japonicus nodulation signaling pathway 1 protein (nsp1) gene, complete cds.
GenBank	EF017372	3e-91	EF017372.1 Lotus japonicus truncated nodulation signaling pathway 1 protein (nsp1) gene, nsp1-1 allele, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003627294.2	2e-30	nodulation-signaling pathway 1 protein
Swissprot	Q4VYC8	2e-30	NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBL	A1DR75	3e-31	A1DR75_LOTJA; Truncated nodulation signaling pathway 1 protein
STRING	AET01770	1e-28	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF6874	34	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13840.1	1e-20	GRAS family protein

Publications ? help Back to Top
Heckmann AB, et al. Lotus japonicus nodulation requires two GRAS domain regulators, one of which is functionally conserved in a non-legume. Plant Physiol., 2006. 142(4): p. 1739-50 [PMID:17071642] Cerri MR, et al. Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection. Plant Physiol., 2012. 160(4): p. 2155-72 [PMID:23077241] Tang H, et al. An improved genome release (version Mt4.0) for the model legume Medicago truncatula. BMC Genomics, 2014. 15: p. 312 [PMID:24767513]