![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj3g3v3212150.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 88aa MW: 10638.4 Da PI: 11.1196 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 59.5 | 6.9e-19 | 2 | 87 | 284 | 373 |
GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
++Ere++gr+++nv+aceg er+ r et+++W+ r ++aGFk+ pl++k +++ ++ lrk + d + ++++++ Wk+r L + W
Lj3g3v3212150.1 2 MIEREMVGRNAMNVIACEGLERIDRPETYKQWQVRNTRAGFKQFPLNQKLVSKFRTKLRKWHHD----DFVNNWMLQSWKGRILSGSTIW 87
79************************************************************77....5679**************9999 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 14.662 | 1 | 72 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 2.4E-16 | 2 | 87 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MMIEREMVGR NAMNVIACEG LERIDRPETY KQWQVRNTRA GFKQFPLNQK LVSKFRTKLR 60 KWHHDDFVNN WMLQSWKGRI LSGSTIWV |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, cotyledons, leaves and sepals. {ECO:0000269|PubMed:18500650}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj3g3v3212150.1 |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004505853.1 | 9e-44 | scarecrow-like protein 34 | ||||
| Swissprot | Q3EDH0 | 4e-30 | SCL31_ARATH; Scarecrow-like protein 31 | ||||
| TrEMBL | A0A1S2YJS7 | 2e-42 | A0A1S2YJS7_CICAR; scarecrow-like protein 34 | ||||
| STRING | XP_004505853.1 | 3e-43 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF14801 | 8 | 13 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G07520.1 | 2e-32 | GRAS family protein | ||||




