![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj3g3v3666580.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 115aa MW: 13043.2 Da PI: 9.2675 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 88.8 | 2.8e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien rqvtfskRr+g+lKKA+EL +LCdaevaviifs+tgk++e+ss
Lj3g3v3666580.1 9 KKIENANSRQVTFSKRRTGLLKKAKELAILCDAEVAVIIFSNTGKMFEFSS 59
68***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.071 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 7.8E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.20E-41 | 2 | 77 | No hit | No description |
| SuperFamily | SSF55455 | 6.02E-33 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.9E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.8E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.9E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.9E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MGRGKIEIKK IENANSRQVT FSKRRTGLLK KAKELAILCD AEVAVIIFSN TGKMFEFSSS 60 GMKHTLSRYN KCKDSSEAEV VEPKTEELCL TEKEDSKMVD ILKDEIAKLE TKQLR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 1e-21 | 1 | 78 | 1 | 78 | MEF2C |
| 5f28_B | 1e-21 | 1 | 78 | 1 | 78 | MEF2C |
| 5f28_C | 1e-21 | 1 | 78 | 1 | 78 | MEF2C |
| 5f28_D | 1e-21 | 1 | 78 | 1 | 78 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During the reproductive phase, accumulates in immature buds and at the base of the floral organs, and in the receptacle, ovules, anther filaments, and stigma and style of open flowers. Accumulates before fertilization in the cytoplasm in the cells of the egg apparatus and moves into the nucleus during early stages of development following fertilization in the suspensor, embryo, and endosperm, mainly double fertilization derived tissues (at protein level). Highly expressed in developing embryos. In young seedlings, present in the shoot and root apices, lateral root primordia and throughout the vascular system. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:8953767}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed at low levels in flowers and siliques. Also present in seedlings. Detected during embryogenesis and accumulates during early seed development (at protein level). Expressed in shoot apices and the base of leaf petioles. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:16028119, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:8953767}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12226488, ECO:0000269|PubMed:12743119, ECO:0000269|PubMed:14615187, ECO:0000269|PubMed:15084721, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18305206, ECO:0000269|PubMed:19269998, ECO:0000269|PubMed:19767455, ECO:0000269|PubMed:8953767}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj3g3v3666580.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269|PubMed:15686521}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004516227.1 | 1e-60 | agamous-like MADS-box protein AGL15 | ||||
| Swissprot | Q38847 | 7e-43 | AGL15_ARATH; Agamous-like MADS-box protein AGL15 | ||||
| TrEMBL | A0A1S2Z743 | 3e-59 | A0A1S2Z743_CICAR; agamous-like MADS-box protein AGL15 | ||||
| STRING | XP_004516227.1 | 5e-60 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3582 | 32 | 60 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13790.1 | 3e-45 | AGAMOUS-like 15 | ||||




