![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj3g3v3737660.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 47aa MW: 5462.64 Da PI: 11.5675 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 63.8 | 1.8e-20 | 10 | 47 | 2 | 39 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
rien rqvtf+kRr+ +lKKA+ELSvLCdae+ +++
Lj3g3v3737660.1 10 RIENPVHRQVTFCKRRARLLKKAKELSVLCDAEIGLVM 47
8*********************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.3E-17 | 1 | 47 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.01E-20 | 1 | 47 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 24.292 | 1 | 47 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.7E-21 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.6E-19 | 10 | 47 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.7E-21 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.7E-21 | 38 | 47 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 47 aa Download sequence Send to blast |
MARGKVQLRR IENPVHRQVT FCKRRARLLK KAKELSVLCD AEIGLVM |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269|PubMed:11855641}. | |||||
| Uniprot | TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269|PubMed:11855641, ECO:0000269|PubMed:18203871, ECO:0000269|PubMed:7549482}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj3g3v3737660.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT136820 | 5e-65 | BT136820.1 Lotus japonicus clone JCVI-FLLj-11I9 unknown mRNA. | |||
| GenBank | BT143509 | 5e-65 | BT143509.1 Lotus japonicus clone JCVI-FLLj-2J17 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013455350.1 | 2e-24 | agamous-like MADS-box protein AGL12 isoform X2 | ||||
| Swissprot | Q38841 | 5e-23 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
| TrEMBL | A0A072UI38 | 4e-23 | A0A072UI38_MEDTR; MADS-box transcription factor | ||||
| TrEMBL | A0A072UJ04 | 5e-23 | A0A072UJ04_MEDTR; MADS-box transcription factor | ||||
| STRING | XP_004514527.1 | 4e-23 | (Cicer arietinum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71692.1 | 1e-18 | AGAMOUS-like 12 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




