PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj4g3v1223860.1

Common Name

LjPAP

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

MYB

Protein Properties

Length: 197aa MW: 22542.2 Da PI: 6.7756

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj4g3v1223860.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.9	6.5e-20	16	63	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT+eEd++l+++++ +G + WktIa + g++R++k+c++rw++yl Lj4g3v1223860.1 16 RGVWTQEEDQKLAQCIEAHGAKKWKTIAVKSGLNRCGKSCRLRWLNYL 63 899*******************************************97 PP
2	Myb_DNA-binding	53	8.1e-17	69	114	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Lj4g3v1223860.1 69 RGNISDEEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 114 7899****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.775	11	63	IPR017930	Myb domain
SuperFamily	SSF46689	7.34E-30	14	110	IPR009057	Homeodomain-like
SMART	SM00717	8.7E-16	15	65	IPR001005	SANT/Myb domain
Pfam	PF00249	3.1E-17	16	63	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.9E-24	18	70	IPR009057	Homeodomain-like
CDD	cd00167	3.58E-11	19	63	No hit	No description
PROSITE profile	PS51294	24.975	64	118	IPR017930	Myb domain
SMART	SM00717	3.1E-14	68	116	IPR001005	SANT/Myb domain
Pfam	PF00249	4.2E-15	69	114	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.4E-26	71	119	IPR009057	Homeodomain-like
CDD	cd00167	3.10E-11	73	114	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009957	Biological Process	epidermal cell fate specification
GO:0010090	Biological Process	trichome morphogenesis
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048481	Biological Process	plant ovule development
GO:0048629	Biological Process	trichome patterning
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 197 aa Download sequence Send to blast
MAPKNASGPA KKAMNRGVWT QEEDQKLAQC IEAHGAKKWK TIAVKSGLNR CGKSCRLRWL 60 NYLRPNIKRG NISDEEEDLI LRLHKLLGNR WSLIAGRLPG RTDNEIKNYW NSHLCKKLNQ 120 EAEKPETSTA QETIVQNQFT EDSAMLQNKD VVNGSGSSDD SFDLDEFFNF SSGETFEFDW 180 INKYLELDQV SESTQRI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-29	14	119	5	109	B-MYB
1h8a_C	2e-29	14	118	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj4g3v1223860.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB490776	0.0	AB490776.1 Lotus japonicus LjPAP mRNA for R2R3-MYB transcription factor LjPAP, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027335493.1	1e-104	transcription factor MYB114-like
Swissprot	P10290	5e-52	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	C0A1G8	1e-145	C0A1G8_LOTJA; R2R3-MYB transcription factor LjPAP
STRING	XP_004508935.1	1e-102	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2148	32	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13540.1	2e-53	myb domain protein 5

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Yoshida K, et al. Transcriptional control of the dihydroflavonol 4-reductase multigene family in Lotus japonicus. J. Plant Res., 2010. 123(6): p. 801-5 [PMID:20339894] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]