 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Lj4g3v1585870.2 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
| Family |
MYB_related |
| Protein Properties |
Length: 128aa MW: 14426.9 Da PI: 8.9223 |
| Description |
MYB_related family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Lj4g3v1585870.2 | genome | Kazusa | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 47.1 | 5.7e-15 | 49 | 93 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT+eE++l++ + ++ G+g+W+ I+r k+Rt+ q+ s+ qky
Lj4g3v1585870.2 49 PWTEEEHKLFLVGLQKVGKGDWRGISRNYVKTRTPTQVASHAQKY 93
8*******************************************9 PP
|
| Sequence ? help Back to Top |
| Protein Sequence Length: 128 aa
Download sequence Send
to blast |
MGESVSMNNL SQYELPQDAN NNNNSNNKDV IAADYASADN AAPPSSGVPW TEEEHKLFLV 60 GLQKVGKGDW RGISRNYVKT RTPTQVASHA QKYFLRRSNL NRRRRRSSLF DITTDTVSAI 120 QVEEEQVQ
|
| Expression -- UniGene
? help Back to Top |
| UniGene ID |
E-value |
Expressed in |
| Lja.7186 | 4e-93 | cell culture| floral bud| flower| pod| protoplast| root |
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: Accumulates during leaf expansion. First observed at the tip of the leaves 12 days after sowing (DAS). At 14 DAS, expressed throughout the leaf blade to fade out thereafter in a basipetal manner. In mature leaves, detected in vascular tissue, especially in companion cells (PubMed:24806884). Accumulates to higher levels in old rosette leaves than in young rosette and cauline leaves (PubMed:25920996). {ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. |
| Uniprot | TISSUE SPECIFICITY: Expressed ubiquitously, except in hypocotyls, root tips and lateral root primordia. {ECO:0000269|PubMed:25920996}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | FJ550209 | 3e-93 | FJ550209.1 Glycine max cultivar Harosoy63 isoflavonoid regulator (MYB176) mRNA, complete cds. |
| GenBank | KT031191 | 3e-93 | KT031191.1 Glycine max clone HN_CCL_30 MYB/HD-like transcription factor (Glyma05g01640.1) mRNA, complete cds. |