![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj4g3v1646660.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 163aa MW: 19133.1 Da PI: 9.3014 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 183.4 | 5.5e-57 | 16 | 142 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94
lppGfrFhPtdeel+++yL kkv + ++++ ++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++
Lj4g3v1646660.1 16 LPPGFRFHPTDEELISHYLYKKVIDIEFSA-RAIGEVDLNKCEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFR 108
79**************************99.89***************888999**************************************** PP
NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
+++lvg+kktLvfykgrapkgek++Wvmheyrle
Lj4g3v1646660.1 109 -GKSLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 142
.999*****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 4.97E-62 | 12 | 153 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 55.66 | 16 | 163 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.9E-30 | 17 | 141 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 163 aa Download sequence Send to blast |
MENISVLSKE EDQMDLPPGF RFHPTDEELI SHYLYKKVID IEFSARAIGE VDLNKCEPWD 60 LPWKAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIFRGK SLVGMKKTLV 120 FYKGRAPKGE KSNWVMHEYR LEGKFSVHNL PKTAKVIDCP VFF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 7e-53 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 7e-53 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 7e-53 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 7e-53 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 7e-53 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 7e-53 | 13 | 141 | 14 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 7e-53 | 13 | 141 | 14 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj4g3v1646660.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT094159 | 1e-144 | BT094159.1 Soybean clone JCVI-FLGm-18C12 unknown mRNA. | |||
| GenBank | EU661925 | 1e-144 | EU661925.1 Glycine max NAC domain protein (NAC28) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027331675.1 | 1e-108 | NAC domain-containing protein 100-like | ||||
| Swissprot | Q9FLJ2 | 1e-100 | NC100_ARATH; NAC domain-containing protein 100 | ||||
| TrEMBL | C6T9I7 | 1e-104 | C6T9I7_SOYBN; Uncharacterized protein (Fragment) | ||||
| TrEMBL | R4N7I9 | 1e-104 | R4N7I9_JATCU; NAC transcription factor 002 | ||||
| STRING | GLYMA17G10970.1 | 1e-105 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF409 | 34 | 171 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G61430.1 | 1e-102 | NAC domain containing protein 100 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




