![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj5g3v1597270.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 167aa MW: 18652.8 Da PI: 8.7783 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 110.2 | 9.2e-35 | 10 | 67 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+Dgy+WrKYGqK vk+s+fprsYYrCtsa+C+vkk+vers +dp++v++tYeg+H+h+
Lj5g3v1597270.1 10 EDGYRWRKYGQKAVKNSPFPRSYYRCTSASCNVKKRVERSFTDPSIVVTTYEGQHTHS 67
8********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.6E-33 | 2 | 69 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.44E-29 | 3 | 69 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 31.743 | 4 | 69 | IPR003657 | WRKY domain |
| SMART | SM00774 | 3.2E-40 | 9 | 68 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.1E-27 | 10 | 66 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009624 | Biological Process | response to nematode | ||||
| GO:0009733 | Biological Process | response to auxin | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 167 aa Download sequence Send to blast |
MTKSEVDHLE DGYRWRKYGQ KAVKNSPFPR SYYRCTSASC NVKKRVERSF TDPSIVVTTY 60 EGQHTHSSPV MPRAGFGGAP IRPGYSTACG ATNFGSVLQG NYLSQYQHHP HQHLVNTLSS 120 LQGFPYSDSP SSKNAAFVTQ EMQHATAFLM DHGLLQDVVP SHMLKEE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 2e-29 | 2 | 70 | 10 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 2e-29 | 2 | 70 | 10 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Lja.13314 | 0.0 | cell culture| protoplast | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00069 | PBM | Transfer from AT2G47260 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj5g3v1597270.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT096266 | 2e-70 | BT096266.1 Soybean clone JCVI-FLGm-20H23 unknown mRNA. | |||
| GenBank | DQ322697 | 2e-70 | DQ322697.1 Glycine max WRKY51 mRNA, complete cds. | |||
| GenBank | DQ322698 | 2e-70 | DQ322698.1 Glycine max WRKY54 mRNA, complete cds. | |||
| GenBank | KT031230 | 2e-70 | KT031230.1 Glycine max clone HN_CCL_159 WRKY transcription factor (Glyma03g37940.1) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003591381.1 | 8e-74 | probable WRKY transcription factor 23 | ||||
| Swissprot | O22900 | 4e-51 | WRK23_ARATH; WRKY transcription factor 23 | ||||
| TrEMBL | A0A445LI01 | 6e-73 | A0A445LI01_GLYSO; WRKY transcription factor 23 isoform C | ||||
| TrEMBL | A0A445LI12 | 5e-73 | A0A445LI12_GLYSO; WRKY transcription factor 23 isoform B | ||||
| TrEMBL | G7ICW1 | 2e-72 | G7ICW1_MEDTR; WRKY transcription factor | ||||
| STRING | AES61632 | 3e-73 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1002 | 34 | 114 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47260.1 | 2e-53 | WRKY DNA-binding protein 23 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




