![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj5g3v2063130.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 118aa MW: 13078.4 Da PI: 11.2685 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 75.1 | 5.7e-24 | 13 | 60 | 2 | 49 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
+i +s rqvtfskRrng++KKA+EL++LC++e +iifs++gk++ +
Lj5g3v2063130.1 13 KIIKESSRQVTFSKRRNGLFKKASELCTLCGVELVLIIFSPSGKVFSF 60
5667899**************************************988 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 24.866 | 4 | 64 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.2E-30 | 4 | 63 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.79E-28 | 5 | 79 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.3E-20 | 6 | 26 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.9E-26 | 13 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.3E-20 | 26 | 41 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.3E-20 | 41 | 62 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MKGRGRKIIE IKKIIKESSR QVTFSKRRNG LFKKASELCT LCGVELVLII FSPSGKVFSF 60 GHPGVEDVIQ RYLSQDPPQP LKSCGTSRFN GTLTCVSSTR ISRISTTMLA LARIMGRS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3kov_A | 4e-18 | 5 | 80 | 1 | 76 | Myocyte-specific enhancer factor 2A |
| 3kov_B | 4e-18 | 5 | 80 | 1 | 76 | Myocyte-specific enhancer factor 2A |
| 3kov_I | 4e-18 | 5 | 80 | 1 | 76 | Myocyte-specific enhancer factor 2A |
| 3kov_J | 4e-18 | 5 | 80 | 1 | 76 | Myocyte-specific enhancer factor 2A |
| 3p57_A | 4e-18 | 5 | 80 | 1 | 76 | Myocyte-specific enhancer factor 2A |
| 3p57_B | 4e-18 | 5 | 80 | 1 | 76 | Myocyte-specific enhancer factor 2A |
| 3p57_C | 4e-18 | 5 | 80 | 1 | 76 | Myocyte-specific enhancer factor 2A |
| 3p57_D | 4e-18 | 5 | 80 | 1 | 76 | Myocyte-specific enhancer factor 2A |
| 3p57_I | 4e-18 | 5 | 80 | 1 | 76 | Myocyte-specific enhancer factor 2A |
| 3p57_J | 4e-18 | 5 | 80 | 1 | 76 | Myocyte-specific enhancer factor 2A |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:18334668}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj5g3v2063130.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP006142 | 1e-80 | AP006142.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjT08A24, TM0250, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003592558.1 | 6e-35 | agamous-like MADS-box protein AGL62 | ||||
| Swissprot | Q9FKK2 | 3e-28 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
| TrEMBL | A0A2K3LZS0 | 3e-34 | A0A2K3LZS0_TRIPR; MADS-box transcription factor | ||||
| STRING | AES62809 | 2e-34 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2424 | 29 | 79 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G24840.1 | 1e-25 | AGAMOUS-like 61 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




