![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lj6g3v1720580.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 127aa MW: 14119 Da PI: 5.3067 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 188.7 | 4e-59 | 24 | 119 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
reqdrflPianvsrimkk+lPan+kisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyveplk+yl+kyre+eg
Lj6g3v1720580.1 24 REQDRFLPIANVSRIMKKALPANGKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKIYLHKYREMEG 117
89******************************************************************************************** PP
NF-YB 96 ek 97
ek
Lj6g3v1720580.1 118 EK 119
98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.4E-54 | 22 | 120 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.29E-41 | 26 | 121 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.1E-28 | 29 | 93 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.5E-21 | 57 | 75 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 60 | 76 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.5E-21 | 76 | 94 | No hit | No description |
| PRINTS | PR00615 | 1.5E-21 | 95 | 113 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
MAESDNESGG QTGGGHTGEL LGCREQDRFL PIANVSRIMK KALPANGKIS KEAKETVQEC 60 VSEFISFITG EASDKCQKEK RKTINGDDLL WAMTTLGFED YVEPLKIYLH KYREMEGEKT 120 GGMVQKI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 3e-49 | 18 | 114 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lj6g3v1720580.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001238398.2 | 2e-76 | H4 superfamily | ||||
| Refseq | XP_028248247.1 | 2e-76 | nuclear transcription factor Y subunit B-3-like | ||||
| Swissprot | O23310 | 9e-70 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | A0A445IVC8 | 4e-75 | A0A445IVC8_GLYSO; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | I1L037 | 4e-75 | I1L037_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA09G01650.1 | 7e-76 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 1e-67 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




