PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lsa014824

Organism

Lactuca sativa

Taxonomic ID

4236

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca

Family

MYB

Protein Properties

Length: 226aa MW: 26320.3 Da PI: 6.3965

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Lsa#S58675787	PU_ref	Unigene	View CDS
PUT-187a-Lactuca_sativa-27751	PU_unref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	45.7	1.5e-14	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ +++++G +W + + + g+ Rt+k+c++rw +yl Lsa014824 14 KGAWTAEEDKKLLTYINKYGIWNWCKMPPYAGLSRTGKSCRLRWMNYL 61 79****************99**********************97 PP
2	Myb_DNA-binding	55.8	1e-17	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T eE+e ++ + +G++ W++Iar+++ gRt++++k++w+++l Lsa014824 67 RGNFTSEEEETIIYHHSIYGNR-WSAIARKLP-GRTDNEVKNYWHTHL 112 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	12.83	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.34E-29	11	108	IPR009057	Homeodomain-like
SMART	SM00717	2.6E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	5.2E-13	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.3E-23	15	68	IPR009057	Homeodomain-like
CDD	cd00167	2.02E-10	16	61	No hit	No description
PROSITE profile	PS51294	25.729	62	116	IPR017930	Myb domain
SMART	SM00717	6.1E-17	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.6E-14	67	112	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.0E-26	69	116	IPR009057	Homeodomain-like
CDD	cd00167	5.50E-12	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 226 aa Download sequence Send to blast
MRAPQYDALS GLNKGAWTAE EDKKLLTYIN KYGIWNWCKM PPYAGLSRTG KSCRLRWMNY 60 LRPNIKRGNF TSEEEETIIY HHSIYGNRWS AIARKLPGRT DNEVKNYWHT HLKKQVTKYR 120 MSETKPAEIK TLNNDVESSI ESTTDHIFSS ITDDHDTSSC LFDICSRCEP KANFETNFNM 180 SSPGTVEDVE SFWQQLYSNN EDLKFQYLPE DTFSNESVVS SNLHDI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-28	8	116	1	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor positively regulating indolic glucosinolate biosynthetic pathway genes. {ECO:0000269\|PubMed:17461791, ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23943862}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by touch or wounding. {ECO:0000269\|PubMed:17461791, ECO:0000269\|PubMed:23115560}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023754336.1	1e-171	transcription factor MYB74-like isoform X2
Swissprot	O49782	2e-49	MYB51_ARATH; Transcription factor MYB51
TrEMBL	A0A2J6MHQ9	1e-170	A0A2J6MHQ9_LACSA; Uncharacterized protein

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G18570.1	7e-52	myb domain protein 51

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Benstein RM, et al. Arabidopsis phosphoglycerate dehydrogenase1 of the phosphoserine pathway is essential for development and required for ammonium assimilation and tryptophan biosynthesis. Plant Cell, 2013. 25(12): p. 5011-29 [PMID:24368794] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Frerigmann H,Gigolashvili T MYB34, MYB51, and MYB122 distinctly regulate indolic glucosinolate biosynthesis in Arabidopsis thaliana. Mol Plant, 2014. 7(5): p. 814-28 [PMID:24431192] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Peskan-Berghöfer T, et al. Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots. New Phytol., 2015. 208(3): p. 873-86 [PMID:26075497] Frerigmann H,Glawischnig E,Gigolashvili T The role of MYB34, MYB51 and MYB122 in the regulation of camalexin biosynthesis in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 654 [PMID:26379682] Frerigmann H, et al. Regulation of Pathogen-Triggered Tryptophan Metabolism in Arabidopsis thaliana by MYB Transcription Factors and Indole Glucosinolate Conversion Products. Mol Plant, 2016. 9(5): p. 682-695 [PMID:26802248] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Xu J, et al. Pathogen-Responsive MPK3 and MPK6 Reprogram the Biosynthesis of Indole Glucosinolates and Their Derivatives in Arabidopsis Immunity. Plant Cell, 2016. 28(5): p. 1144-62 [PMID:27081184] Miao H, et al. Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation. Sci Rep, 2016. 6: p. 31854 [PMID:27549907]