PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lus10001043

Organism

Linum usitatissimum

Taxonomic ID

4006

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum

Family

MYB_related

Protein Properties

Length: 161aa MW: 17991.8 Da PI: 4.8117

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lus10001043	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	46.4	9.4e-15	70	113	3	48
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 ++ ++E++l+++++++lG + W++Ia +++ gRt+k++ ++w++y+ Lus10001043 70 KFGEDEEDLIIKLHALLGDR-WSLIAGRLP-GRTDKEIENYWNSYM 113 7889************99.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	21.498	63	117	IPR017930	Myb domain
SMART	SM00717	2.7E-13	67	115	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.2E-12	69	123	IPR009057	Homeodomain-like
CDD	cd00167	5.85E-11	70	113	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.8E-19	70	114	IPR009057	Homeodomain-like
Pfam	PF00249	8.7E-14	70	112	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 161 aa Download sequence Send to blast
MSTEENDDVS KQVSNSKQVE EATSHGGQGC SCSDAAGGLY RRCGKRCRLR GMEESSRPDV 60 DENDMKRHRK FGEDEEDLII KLHALLGDRW SLIAGRLPGR TDKEIENYWN SYMKRKLMSM 120 GIDPNNHRPN QPAVVVGPYD QPVTDSEDDG LSDATSFLQE *

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lus10001043

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001314002.1	7e-43	transcription repressor MYB6-like
Refseq	XP_016701608.1	1e-42	PREDICTED: transcription repressor MYB6-like
Swissprot	Q9S9K9	5e-33	MYB3_ARATH; Transcription factor MYB3
TrEMBL	A9LMX8	6e-42	A9LMX8_GOSHI; Myb-like transcription factor 6 (Fragment)
STRING	Lus10001043	1e-117	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF16722	7	8

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	2e-35	myb domain protein 3

Link Out ? help Back to Top
Phytozome	Lus10001043

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]