PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lus10002481

Organism

Linum usitatissimum

Taxonomic ID

4006

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum

Family

Trihelix

Protein Properties

Length: 60aa MW: 7217.61 Da PI: 10.8935

Description

Trihelix family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lus10002481	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	trihelix	59.6	7.9e-19	2	52	13	63
trihelix 13 arremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykk 63 +r e+++++ ++k++k lWe +++km+e+gf rsp+qCk+kw+nl +ryk+ Lus10002481 2 IRAELDRTFMETKRNKLLWEVIASKMKEKGFLRSPEQCKCKWKNLVTRYKR 52 7999**********************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd12203	4.96E-18	1	52	No hit	No description
Pfam	PF13837	3.8E-14	5	52	No hit	No description

Sequence ? help Back to Top
Protein Sequence Length: 60 aa Download sequence Send to blast
MIRAELDRTF METKRNKLLW EVIASKMKEK GFLRSPEQCK CKWKNLVTRY KRDLRTVNV*

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may play a role in the induction of CAM4 in response to pathogen and salt. {ECO:0000269\|PubMed:15310827}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lus10002481

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt and infection with the bacterial pathogen P.syringae pv tomato. {ECO:0000269\|PubMed:15310827}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010104264.2	1e-26	trihelix transcription factor GT-3b
Swissprot	O80450	4e-23	TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBL	W9RYU5	3e-25	W9RYU5_9ROSA; Trihelix transcription factor GT-3b
STRING	Lus10002481	8e-36	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1781	33	85

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G38250.1	2e-25	Trihelix family protein

Link Out ? help Back to Top
Phytozome	Lus10002481

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]