PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lus10002763

Organism

Linum usitatissimum

Taxonomic ID

4006

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum

Family

M-type_MADS

Protein Properties

Length: 94aa MW: 10602.1 Da PI: 9.8697

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lus10002763	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.9	4.8e-32	26	76	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fss+g+lyey++ Lus10002763 26 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYAN 76 79***********************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.5E-41	18	77	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.571	18	78	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.96E-30	19	78	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.73E-40	19	78	No hit	No description
PRINTS	PR00404	8.0E-34	20	40	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	20	74	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.1E-27	27	74	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.0E-34	40	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.0E-34	55	76	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MSGYQSDSRE DSPSQRKIGR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY ELSVLCDAEI 60 ALIVFSSRGR LYEYANNSSS FHLQILIGGM DQL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-21	18	77	1	60	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-21	18	77	1	60	Myocyte-specific enhancer factor 2B
1tqe_R	2e-21	18	77	1	60	Myocyte-specific enhancer factor 2B
1tqe_S	2e-21	18	77	1	60	Myocyte-specific enhancer factor 2B
6c9l_A	2e-21	18	77	1	60	Myocyte-specific enhancer factor 2B
6c9l_B	2e-21	18	77	1	60	Myocyte-specific enhancer factor 2B
6c9l_C	2e-21	18	77	1	60	Myocyte-specific enhancer factor 2B
6c9l_D	2e-21	18	77	1	60	Myocyte-specific enhancer factor 2B
6c9l_E	2e-21	18	77	1	60	Myocyte-specific enhancer factor 2B
6c9l_F	2e-21	18	77	1	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lus10002763

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015576689.1	3e-43	floral homeotic protein AGAMOUS
Swissprot	Q43585	3e-41	AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBL	A0A0P0HVT9	8e-43	A0A0P0HVT9_MERAN; Agamous 2-like protein
STRING	Lus10002763	1e-62	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	5e-30	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Lus10002763

Publications ? help Back to Top
Cheung AY,Zhan XY,Wang H,Wu HM Organ-specific and Agamous-regulated expression and glycosylation of a pollen tube growth-promoting protein. Proc. Natl. Acad. Sci. U.S.A., 1996. 93(9): p. 3853-8 [PMID:8632979]