 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Lus10003848 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
| Family |
NAC |
| Protein Properties |
Length: 102aa MW: 11662.2 Da PI: 6.5177 |
| Description |
NAC family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Lus10003848 | genome | BGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NAM | 96.8 | 3.2e-30 | 14 | 94 | 1 | 84 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84
lp+GfrFhPtd+elv++yL++k +++k + +i+e+d+yk++Pw+Lpk++ +ekewyfFs+rd+ky++g+r+nra +g+W
Lus10003848 14 LPAGFRFHPTDDELVTHYLCRKYSDQKPAA-PIIAELDLYKFDPWELPKMAMYGEKEWYFFSPRDRKYPNGSRPNRA--AGFWL 94
799************************777.88***************7666789*********************8..79995 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Involved in disease resistance response (PubMed:16115070, PubMed:19625399). May function as repressor of pathogenesis-related proteins (PubMed:16115070). May function in the regulation of host basal defense responses against viral infection (PubMed:19625399). Transcriptional activator involved in responses to wounding and infection with tobamovirus (TMV) (PubMed:22937923). Binds to the DNA sequences 5'-AAAATATCT-3' and 5'AGATTTTT-3' of CYP734A1/BAS1 and CYP72C1/SOB7 promoters, respectively. Acts as suppressor of the brassinosteroid (BR)-inactivating enzymes CYP734A1/BAS1 and CYP72C1/SOB7, and prevents their expression in almost all tissues. Plays a central role in integrating BR homeostasis and seedling development. Regulates the spatial regulation of BR homeostasis and participates in the regulation of hypocotyl elongation and root growth by suppressing BR catabolism. Mediates connection between BR catabolism and photomorphogenesis (PubMed:26493403). Binds to, and transactivates the promoter of the auxin biosynthetic gene NIT2 (PubMed:22965747). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16115070, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:19625399, ECO:0000269|PubMed:22937923, ECO:0000269|PubMed:22965747, ECO:0000269|PubMed:26493403, ECO:0000269|PubMed:26518251}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Induced by wounding, salicylic acid (SA), methyl jasmonate, drought stress, dark and sucrose starvation (PubMed:16115070). Induced by chitin elicitor (chitooctaose) (PubMed:17722694). Induced by salicylic acid and infection with tobamovirus (TMV) (PubMed:19625399). By indole-3-acetonitrile, salicylic acid (SA), sodium nitroprusside (SNP), salt stress and drought stress (PubMed:22965747). Down-regulated by brassinosteroid (BR) and transition from dark to white light (PubMed:26493403). {ECO:0000269|PubMed:16115070, ECO:0000269|PubMed:17722694, ECO:0000269|PubMed:19625399, ECO:0000269|PubMed:22965747, ECO:0000269|PubMed:26493403}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | FP095209 | 8e-35 | FP095209.1 Phyllostachys edulis cDNA clone: bphylf057o13, full insert sequence. |