![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lus10004637 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 205aa MW: 23891.2 Da PI: 8.6105 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 94.2 | 5.7e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr+g+ KKA+E+SvLCdaeva+i+fs++gkl+ey++
Lus10004637 9 KRIENKINRQVTFSKRRAGLHKKAHEISVLCDAEVALIVFSHKGKLFEYAT 59
79***********************************************86 PP
| |||||||
| 2 | K-box | 95.1 | 1.1e-31 | 77 | 173 | 3 | 99 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99
+++ +++e + ++ e+++Lk++ie L r++Rh++GedL+s+s keLq+LeqqL+++lk+iR+++n+l++e+i lq+kek++qe+n L k+ e
Lus10004637 77 ERQLVATELDSQGNWLMEYNRLKAKIELLLRNHRHYMGEDLDSMSTKELQNLEQQLDSALKNIRTRRNQLMHESITALQRKEKAIQEQNDVLAKQEE 173
56666666677899*****************************************************************************999865 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 7.9E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.777 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.49E-42 | 2 | 79 | No hit | No description |
| SuperFamily | SSF55455 | 3.4E-34 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.6E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.6E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.6E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 7.4E-27 | 86 | 171 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 16.061 | 88 | 178 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 205 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRAGLHK KAHEISVLCD AEVALIVFSH KGKLFEYATD 60 SCMEKILERY ERYSYAERQL VATELDSQGN WLMEYNRLKA KIELLLRNHR HYMGEDLDSM 120 STKELQNLEQ QLDSALKNIR TRRNQLMHES ITALQRKEKA IQEQNDVLAK QEEHHHQGHD 180 ARGRNDLDLT LEPIYSCNLG CFAA* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_B | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_C | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_D | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_A | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_B | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_C | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_D | 3e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lus10004637 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold shock (e.g. from 22/17 to 16/12 degrees Celsius in light/night respectively). {ECO:0000269|PubMed:18332227}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021623236.1 | 1e-114 | truncated transcription factor CAULIFLOWER A | ||||
| Swissprot | B4YPW6 | 1e-111 | AP1A_BRAOA; Floral homeotic protein APETALA 1 A | ||||
| Swissprot | Q8GTF5 | 1e-111 | AP1A_BRAOB; Floral homeotic protein APETALA 1 A | ||||
| Swissprot | Q96356 | 1e-111 | 2AP1_BRAOT; Floral homeotic protein APETALA 1-2 | ||||
| TrEMBL | A0A061EAI9 | 1e-113 | A0A061EAI9_THECC; K-box region and MADS-box transcription factor family protein | ||||
| STRING | Lus10004637 | 1e-150 | (Linum usitatissimum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF588 | 32 | 119 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69120.1 | 1e-111 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Lus10004637 |




